KEGG   Synechococcus sp. PCC7002: SYNPCC7002_G0128Help
Entry
SYNPCC7002_G0128  CDS       T00664                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
syp  Synechococcus sp. PCC7002
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SYNPCC7002_G0128 (folE)
Enzymes [BR:syp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     SYNPCC7002_G0128 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
pAQ7:147982..148620
Genome map
AA seq 212 aa AA seqDB search
MDLPISLTDIRQQTINTEIKPPVSEAEMQAAVRTLLLGLGEDPDREGLRDTPKRLVKALK
FLTSGYHQSLDELLNGAVFHENTNEMVLVRDIDLFSSCEHHILPILGRAHVAYIPNGKVI
GLSKIARICEMYARRLQVQERLTQQIADALHGLLQPQGVAVVVEATHMCMVMRGVEKPGS
WTVTSSMQGIFADNDATRQEFMELIRHRPSFH
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggacttacccatttctttgaccgatattcgccaacaaaccattaatactgaaatcaaa
ccaccagtttcagaagccgaaatgcaggcagccgtgcgcactttattactcggcttaggc
gaagatccagatcgtgaaggattacgcgatacgccgaaacgattggttaaagcccttaaa
tttttgacatctggctaccatcaatccctcgatgaactcctgaacggggctgtgttccat
gaaaataccaatgaaatggtcttagtgcgagatattgatctatttagttcttgcgaacac
catattctgccgattttaggccgcgcccatgtggcctacattccaaatggtaaggtgatc
ggcctctctaaaattgcccgtatttgtgaaatgtacgcccggcgtttacaagtacaagaa
cgcttaacccaacaaattgccgatgccctccatggattattacaaccccagggagtcgct
gttgtggttgaggcaacccacatgtgcatggtgatgcgtggggtcgagaaaccaggctct
tggacagtaaccagttcaatgcagggcatatttgccgacaatgacgccactcgccaagaa
ttcatggagttaattcgccatcgtccttcgttccactag

DBGET integrated database retrieval system