KEGG   Synechocystis sp. PCC 6803 PCC-P: SYNPCCP_0134Help
Entry
SYNPCCP_0134      CDS       T01891                                 

Gene name
sll0228
Definition
arginase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
syq  Synechocystis sp. PCC 6803 PCC-P
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syq00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SYNPCCP_0134 (sll0228)
Enzymes [BR:syq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     SYNPCCP_0134 (sll0228)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(148022..148942)
Genome map
AA seq 306 aa AA seqDB search
MHSPNKFTSGPKQFLESEAITSYADAAVVVVPIPYEATTSYRKGCEHGPEAVLEASDQLE
AYDEELGTSPCHDLGIYTCAPLADSNKHPALAGDAMVTEVCDGIAPFVEDGKFVVAIGGE
HAITTGVVRAMQRGTSEPFTVVQIDAHGDMRDKFEGSCHNHACVMRRVLELGLPTLPIAI
RAICQEEADLIREKNIPVFWAREMADNPNWINEAIASITTQKVFLTIDMDGFDPGFMPGV
GTPEPGGLGWYEGLNFFRRLFQTKQVIGCDLMELAPVRGSVVSEFSTAKLAYKLMGYWGE
SQRKKL
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgcatagtcctaataaatttacctctgggcccaaacagtttctggagtcggaagccatt
acctcctatgctgatgccgctgtggtggtggtgcccattccctatgaggcaactacttcc
taccgtaagggttgtgagcatggccctgaggcggtgctagaagcttcggaccagttggaa
gcctatgacgaagagttgggcacttccccctgccatgatttgggtatttacacctgcgct
cccctggcggacagcaataagcatcccgctttggctggagacgccatggtaacggaggtt
tgtgacggcattgccccttttgtggaagacggtaaatttgtagtggcgatcggtggggaa
catgccattaccactggggtagtgcgggctatgcaaagggggacatcggagccttttacg
gtggtgcaaattgatgcccatggggatatgcgggacaaatttgaaggttcctgccataac
catgcctgtgtaatgcgccgggtgttggaattgggcttacccactctgccgatcgccatt
cgggccatttgtcaggaagaggcagatttgattcgggaaaaaaatattcctgtgttttgg
gccagggaaatggccgataatcccaattggattaacgaggcgatcgccagcatcaccaca
caaaaagtctttctcaccattgatatggacggttttgatccggggtttatgccgggagtc
ggcacccctgaaccgggggggctaggttggtatgaagggttaaattttttccgccgtctt
tttcaaaccaagcaagtaattggttgcgacttgatggaactggccccagtgcgaggctcg
gtggtgtcggaattttctaccgctaaactagcctataagttgatgggttactggggagag
tcccaacggaaaaaactctag

  All links  
No link information was found.   
DBGET integrated database retrieval system