KEGG   Synechocystis sp. PCC 6803 PCC-P: SYNPCCP_0175Help
Entry
SYNPCCP_0175      CDS       T01891                                 

Gene name
folK
Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
syq  Synechocystis sp. PCC 6803 PCC-P
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SYNPCCP_0175 (folK)
Enzymes [BR:syq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     SYNPCCP_0175 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
189128..189715
Genome map
AA seq 195 aa AA seqDB search
MAPVSPTDFPQQCHGAVVGLGGNIGPVLDNLQGAIAELALVAGIEVERCSSWYRSRAFGP
PQPDYINGCVTLRVSLSPPELLQTLLAIEQKFGRIRLEKWGPRTLDLDLIFYGDRQLEQA
RLTIPHPQMQYRPFVLVPLAEIAPDWVDPRSGKTIIQLIEQVDCTAVWPVAPGLELGGSL
EPEQVFAPGAVAVHG
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggctcctgtctcccccacagattttccgcaacaatgccatggggcagtggtaggcttg
gggggcaatattggcccagtgctggacaatctccaaggggcgatcgccgagttggccttg
gtagcgggcattgaagtggagcgctgttctagttggtaccgtagccgagcttttgggccg
ccgcagcccgactatatcaatggctgtgtgacgttacgggtcagtttatcccccccagag
ttgttgcaaactttactggcgatcgagcaaaaatttggccgcattcgtttggaaaaatgg
ggaccccgcaccttagatctggatttaattttctacggcgatcgccaattggaacaggct
agactgaccattccccacccgcaaatgcaatacagaccatttgtgctagttcccctggcg
gaaattgccccggactgggttgatcctcggtcggggaaaaccattattcaactaattgag
caggtggattgcactgcggtttggccagtggctccagggctggaactaggggggagtctg
gaaccagagcaagtttttgcgccgggtgctgtggcggttcacggataa

DBGET integrated database retrieval system