KEGG   Synechocystis sp. PCC 6803 PCC-P: SYNPCCP_1768Help
Entry
SYNPCCP_1768      CDS       T01891                                 

Gene name
slr1171
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
syq  Synechocystis sp. PCC 6803 PCC-P
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:syq00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:syq00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1938013..1938522
Genome map
AA seq 169 aa AA seqDB search
MTAQANNTIYGFSANALDGSPVALRDFEGKVLLIVNTASQCGFTPQYQGLQALYNRFGDR
GFTVLGFPCNQFGQQEPGGSGEIKNFCETRYGVTFPLFEKVEVNGPNAHPLFKFLTAASP
GMAIPFLGGAEDIKWNFTKFLVDRQGKVVKRYGSIAKPDEIAADIEKLL
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgactgcccaagccaacaacacaatctacggtttttctgccaatgccttggatggttcc
cccgtagctctgagggactttgaaggtaaagtgctgttaattgtcaacaccgccagtcaa
tgtggcttcactccccaataccaaggactccaggctctatacaatcgattcggcgatcgg
ggttttacggtgcttggttttccctgtaatcagtttggccagcaggaacccggtggctca
ggggaaattaaaaacttttgcgaaacccgttatggagtaacttttcccttatttgaaaaa
gtggaagtcaatggtcccaacgcccatcccctatttaagtttttaaccgcagctagccct
ggtatggccattccttttttgggtggtgcggaggacattaaatggaatttcactaagttt
ttggtcgatcgccaaggtaaagtggtcaaacgctacggttccatcgccaaacccgatgaa
attgcggcggacatcgagaaattgttgtaa

DBGET integrated database retrieval system