KEGG   Synechocystis sp. PCC 6803 PCC-P: SYNPCCP_2041Help
Entry
SYNPCCP_2041      CDS       T01891                                 

Gene name
odhB
Definition
dihydrolipoamide acetyltransferase component(E2) of pyruvate dehydrogenase complex
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
syq  Synechocystis sp. PCC 6803 PCC-P
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:syq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SYNPCCP_2041 (odhB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYNPCCP_2041 (odhB)
   00020 Citrate cycle (TCA cycle)
    SYNPCCP_2041 (odhB)
   00620 Pyruvate metabolism
    SYNPCCP_2041 (odhB)
Enzymes [BR:syq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SYNPCCP_2041 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2249483..2250784)
Genome map
AA seq 433 aa AA seqDB search
MIYDIFMPALSSTMTEGKIVSWTKSPGDKVEKGETVLVVESDKADMDVESFNEGYLAAIL
VPAGEEAPVGATLGLVVETEAEIAEAQAKAGSGGGSSAAPTATPAPQQPEPVAIASATAI
ETTPAPSSNGNGKGSGRIIASPRAKKLAKELKVDLATIAGTGPHGRIVAADIESAAGKPV
TASIAAPSAPAPKTSPAPTPRVTSTPSVPVGQTVPLTTFQKALVQNMVAAMAAPTFRVGY
TITTDGLDQLYKQIKGKGVTMTALLAKAVALALKKHPIVNASYTDQGIIYHKDVNIALAV
AMPDGGLITPVLQNADQVDIYSLSRRWKELVERARAKQLQPEEYSTGTFTISNLGMFGVD
RFDAILPPGQGGILAVGASRPQVVANEEGLIGTKRQMAVNVTCDHRVIYGAHAAAFLKDL
AVIIEENAQSLTM
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgacattttcatgcccgccctgagttccaccatgaccgaggggaaaattgtt
tcttggactaagtcccccggcgacaaagtggaaaaaggtgaaactgtcttggtggtggaa
tcggacaaagcagatatggacgtggagtcctttaacgaaggttacctagccgccattcta
gttccagcaggggaagaagctcccgtgggggcaacccttggcctagtggtggaaacggaa
gcggaaattgccgaagcccaagctaaagctggctctggtggtggttctagtgcggctccg
actgcaaccccagccccccaacaacctgaaccagtggcgatcgccagtgcaactgccata
gagacaactccggcccctagcagtaacggcaatggcaaaggcagtgggcgaattattgct
tccccccgggcgaaaaaactagccaaagagttaaaagttgatttagctaccattgctggc
actggcccccacggcagaattgtggccgcagatattgaaagtgccgctggtaaacccgtc
actgcttccatcgctgcccccagtgccccagctcctaaaacatcccctgcccctactcca
agggtaacctctacccccagtgttcccgtcggccagacagtacccctgaccactttccaa
aaagctttggtgcaaaatatggtggccgccatggccgctcctacattccgagtgggctac
accatcaccaccgatggactggatcaactttataaacaaatcaaaggcaaaggggtgact
atgacggccctgttggctaaagctgtggctctggccttgaaaaaacatcccattgtcaac
gccagctacactgaccaaggcatcatctaccacaaggatgtcaacattgctctggccgta
gccatgcccgatggcggtttaattactccggtgttgcaaaatgcagaccaagtagatatc
tactccctctcccgccgatggaaagaattggtggaacgggcccgggctaagcagttacag
cctgaagaatacagcactggcactttcactatttctaacctgggtatgtttggggtagac
cgatttgatgccattctaccgccgggtcaagggggaattttagcggtgggtgcttcccgt
ccccaagtagtggccaatgaggaaggtttgattggtaccaaacgacaaatggcggttaat
gtaacctgtgaccatcgggtaatttatggggcccatgccgccgctttcctgaaggatttg
gctgtcattattgaagagaatgcccagtctttgactatgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system