KEGG   Synechocystis sp. PCC 6803 PCC-P: SYNPCCP_2066Help
Entry
SYNPCCP_2066      CDS       T01891                                 

Gene name
xylR
Definition
(GenBank) xylose repressor
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
syq  Synechocystis sp. PCC 6803 PCC-P
Pathway
syq00010  Glycolysis / Gluconeogenesis
syq00052  Galactose metabolism
syq00500  Starch and sucrose metabolism
syq00520  Amino sugar and nucleotide sugar metabolism
syq00521  Streptomycin biosynthesis
syq01100  Metabolic pathways
syq01110  Biosynthesis of secondary metabolites
syq01120  Microbial metabolism in diverse environments
syq01130  Biosynthesis of antibiotics
syq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:syq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYNPCCP_2066 (xylR)
   00052 Galactose metabolism
    SYNPCCP_2066 (xylR)
   00500 Starch and sucrose metabolism
    SYNPCCP_2066 (xylR)
   00520 Amino sugar and nucleotide sugar metabolism
    SYNPCCP_2066 (xylR)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SYNPCCP_2066 (xylR)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SYNPCCP_2066 (xylR)
Enzymes [BR:syq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SYNPCCP_2066 (xylR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: BAL36152
Position
2281620..2282603
Genome map
AA seq 327 aa AA seqDB search
MLVWLPWGVELARFSQFSLNGMSSPSSIHREVIGIDIGGSSIKFGRFLSNGDCTESLVLP
TPQPALPKAVYAQLAHGIDLLKNSACVAIGVGMPGPADAAGRVAQLAINLPQWHDIPLAD
WLEDHGQLPTVLENDANCAGLGEAWLGAGRDYRNFILLTLGTGVGGAVFLNGKLFTGPQG
AGGELGLISIETEGYPCNSGNRGSLEQHASAQTLRREMNLTGLELAQLAAKGDAEAIAYW
EKFGQRLGMGIANLVYVLTPEAVIIGGGLSASSSYFFPSMASEIEERVLLPSRRGLKILV
AQLGNRAGMIGAARLAWQKLVYRTDGP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
gtgctggtatggctcccctggggggtagaattagcaagattttcccaattttcccttaat
ggcatgagttctccctcttccatacatcgtgaagtcatcggcattgacattggtggttct
tccattaagtttggccggttcctgagcaatggagattgcaccgagtccttggttttgccc
accccccaaccggctttacccaaggcagtttatgctcagttggcccatggtattgacctg
ttgaaaaattcagcttgtgtggcgatcggtgttgggatgccgggaccagcggacgcagca
ggacgggtggcccagttggcaattaatttgccccagtggcacgacattcctttggcggat
tggttggaagaccatggacagttgccgacggtattggagaatgatgccaattgtgctggc
ttgggggaagcttggctcggagcgggcagggattatcgtaattttattttgcttaccctg
ggcacgggggtggggggggcggtgtttttaaatggcaaattgtttacggggccccaagga
gccgggggggaattgggactaatttccattgaaacggaaggctatccttgcaatagcggc
aatcggggttctttggagcaacatgcttctgcccaaaccctacggcgggaaatgaatttg
accggcctggaattggcccaattggccgccaagggggatgcggaggcgatcgcctactgg
gaaaagttcggccagcggttgggcatgggcattgcgaacttggtctatgtgttgacccca
gaggcagtaattattgggggagggctaagcgccagctccagttacttttttccctccatg
gcatcggaaattgaggaaagggtgctattaccttcccgtcggggattaaaaattttggtg
gcccaactgggtaaccgagctggcatgatcggtgcggcccgcctagcctggcaaaagttg
gtttatcgcaccgatggcccttga

DBGET integrated database retrieval system