KEGG   Synechocystis sp. PCC 6803 PCC-P: SYNPCCP_2178Help
Entry
SYNPCCP_2178      CDS       T01891                                 

Gene name
tpi
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
syq  Synechocystis sp. PCC 6803 PCC-P
Pathway
syq00010  Glycolysis / Gluconeogenesis
syq00051  Fructose and mannose metabolism
syq00562  Inositol phosphate metabolism
syq00710  Carbon fixation in photosynthetic organisms
syq01100  Metabolic pathways
syq01110  Biosynthesis of secondary metabolites
syq01120  Microbial metabolism in diverse environments
syq01130  Biosynthesis of antibiotics
syq01200  Carbon metabolism
syq01230  Biosynthesis of amino acids
Module
syq_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:syq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYNPCCP_2178 (tpi)
   00051 Fructose and mannose metabolism
    SYNPCCP_2178 (tpi)
   00562 Inositol phosphate metabolism
    SYNPCCP_2178 (tpi)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SYNPCCP_2178 (tpi)
Enzymes [BR:syq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SYNPCCP_2178 (tpi)
Exosome [BR:syq04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SYNPCCP_2178 (tpi)
  Exosomal proteins of bladder cancer cells
   SYNPCCP_2178 (tpi)
  Exosomal proteins of melanoma cells
   SYNPCCP_2178 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Hs1pro-1_N
Motif
Other DBs
NCBI-ProteinID: BAL36264
Position
2421447..2422175
Genome map
AA seq 242 aa AA seqDB search
MRKIIIAGNWKMHKTQAEAQAFLQGFKPLIEDAAESREVVLCVPFTDLSGMSQQLHGGRV
RLGAQNVHWEASGAYTGEISAAMLTEIGIHYVVIGHSERRQYFGETDETANLRVLAAQKA
GLIPILCVGESKAQRDAGETEQVIVDQVKKGLVNVDQSNLVIAYEPIWAIGTGDTCAATE
ANRVIGLIREQLTNSQVTIQYGGSVNANNVDEIMAQPEIDGALVGGASLEPQSFARIVNF
QP
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaaaaatcattattgcgggcaattggaaaatgcataagacgcaggcggaggcccaa
gcgtttttgcaggggtttaaacctttaatcgaagatgcggcggaaagtcgtgaggtggtg
ttgtgtgttcctttcaccgatttgagcggcatgtcccaacaactccatggcggtagggtc
cgcctaggggcacaaaatgtccattgggaagcgagtggggcctacacaggggaaatttca
gcggctatgttgacggaaatcggtattcattatgtggttatcggccacagtgaacgacgg
caatattttggggaaacggacgaaactgccaatttgagagtattggcggcccaaaaggcg
ggcttaattcccattctgtgtgtgggggaaagtaaggcgcaacgggatgccggagaaacg
gaacaggttatcgttgaccaagtgaaaaaaggcttggtgaatgtggatcaatctaaccta
gtcatcgcctacgagccgatttgggccattggtacaggggacacctgtgcggcaacggaa
gccaatcgggttattgggctgattcgggaacagttaactaattcccaggtcaccatccag
tatggcggttcggtcaatgccaacaatgtggatgaaattatggcccaaccggaaattgat
ggagccttggtgggaggagctagtctggaaccccagagctttgcccgcattgttaatttt
cagccctga

DBGET integrated database retrieval system