KEGG   Synechocystis sp. PCC 6803 PCC-P: SYNPCCP_2216Help
Entry
SYNPCCP_2216      CDS       T01891                                 

Gene name
sll0019
Definition
hypothetical protein
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
syq  Synechocystis sp. PCC 6803 PCC-P
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:syq00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SYNPCCP_2216 (sll0019)
Enzymes [BR:syq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     SYNPCCP_2216 (sll0019)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2467071..2468255)
Genome map
AA seq 394 aa AA seqDB search
MVKRISILGSTGSIGTQTLDIVTHHPDAFQVVGLAAGGNVALLAQQVAEFRPEIVAIRQA
EKLEDLKAAVAELTDYQPMYVVGEEGVVEVARYGDAESVVTGIVGCAGLLPTMAAIAAGK
DIALANKETLIAGAPVVLPLVEKMGVKLLPADSEHSAIFQCLQGVPEGGLRRIILTASGG
AFRDLPVERLPFVTVQDALKHPNWSMGQKITIDSATLMNKGLEVIEAHYLFGLDYDHIDI
VIHPQSIIHSLIEVQDTSVLAQLGWPDMRLPLLYALSWPERIYTDWEPLDLVKAGSLSFR
EPDHDKYPCMQLAYGAGRAGGAMPAVLNAANEQAVALFLQEKISFLDIPRLIEKTCDLYV
GQNTASPDLETILAADQWARRTVLENSACVATRP
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaacgcatttctatcctcggctccaccggttccattggtacccaaactctggac
attgttacccatcatcctgatgcttttcaggtggtcggtttagcggctgggggaaatgtt
gcattactagcccaacaggtggcggagtttcgcccagagattgttgcgattcgtcaggca
gaaaagttagaggacctaaaagcagcagtggccgaactaactgattaccaacccatgtac
gtggtgggggaagaaggggtggtggaagtggcccgttatggtgatgcagaaagtgtggtc
acaggtattgtcggttgtgcgggattattacccaccatggcggcgatcgccgccgggaaa
gatattgctttagccaataaggaaacgttaattgccggagctccggtggtgttacccctg
gtggaaaaaatgggggtgaagttattgccggcggattcagaacattcagccatttttcaa
tgtttacagggggttcccgaaggggggttacggcggatcattctcaccgcttccggggga
gcattccgggacttgccggtggaaagattaccgtttgtaacagtacaggatgccctcaaa
catcccaactggtctatgggacaaaaaatcaccattgattccgccacattgatgaacaag
ggtttggaggtgattgaagcccattatctatttggcttggactacgatcatatagacatt
gtcattcatccccaaagcattattcattctttaattgaggtgcaggatacttctgtgcta
gctcaactggggtggcctgatatgcgtttgccgttgctctatgccctatcttggccagaa
agaatttacaccgactgggaacctttggatttagttaaagccggtagcttgagttttcgg
gagccagatcacgataaatatccctgcatgcaattggcctatggggccgggcgagctggg
ggagccatgccagcggtgttaaatgcggccaatgaacaggcggtggctttatttttgcaa
gaaaaaattagctttttggatattccccgtctgattgaaaagacctgtgacctctacgtt
ggtcaaaatactgctagccctgatttagaaacaattttggcagcggatcaatgggcccgg
cggacggtgttggaaaatagcgcctgtgtggctactcggccataa

DBGET integrated database retrieval system