KEGG   Synechocystis sp. PCC 6803 PCC-P: SYNPCCP_2232Help
Entry
SYNPCCP_2232      CDS       T01891                                 

Gene name
murZ
Definition
UDP-N-acetylglucosamine1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
syq  Synechocystis sp. PCC 6803 PCC-P
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syq00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SYNPCCP_2232 (murZ)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SYNPCCP_2232 (murZ)
Enzymes [BR:syq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     SYNPCCP_2232 (murZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2484433..2485749
Genome map
AA seq 438 aa AA seqDB search
MLQVATPTATEETQTVIEIEGRASLKGEVRISGAKNSALAIMAGTILCSDDCRLSNLPAL
ADIDKMCQILAAIGVNLERDGDRLVVDSSNVGHGPAPYELVSQLRASFFVIGPLLSRLGM
TKVPLPGGCAIGTRPVDLHVRGLQAMGADVHIEHGVVNASIKGHSRRLTGAKIYLDYPSV
GATETILMAATLAEGETVIDNAAREPEIVDLANFCRSMGAQIRGDGSSRIIINGVEKLHS
TDFPIIPDRIEAATFLCAGAITHSEISLFPVVPDHLASAIAKLREIGPEVAIDAPDRVRL
IPRDLRGTDIETLPYPGFPTDMQAQFMALLAVSEGNSVVTETVFENRLQHVAELQRMGAN
IKLKGNAAFIQGVPFLSGAPVMSTDLRASAALVIAGLAAEGKTIVQGLRHLDRGYEDIEG
KLRKLGAKLTRIEQPVTL
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
gtgcttcaagttgctactcctaccgctaccgaagaaacccagacggtcattgaaattgaa
ggccgggcctccctaaaaggggaagttcgcatcagtggggctaaaaattccgctttggcc
atcatggccggcaccatcctttgttccgacgactgtcgtcttagtaatctgcccgctctg
gcggatattgacaaaatgtgccaaattttggcggccattggggtcaatctagaacgggat
ggcgatcgcctcgtagtggattccagtaatgtgggccatggccctgccccctatgagtta
gtgtcccaactgcgggctagctttttcgtcattggccctttactgtcccgtttaggcatg
accaaagtacccctgcctgggggatgcgccattgggactcggcccgttgatctccatgtg
cggggtttgcaggccatgggagcagacgttcacatcgagcatggggtagtcaatgccagc
atcaagggccacagccgtcgtttgaccggagctaaaatttatctggattatcccagcgta
ggggccacggaaactatcctcatggccgccaccctagcggaaggagaaacagtaattgat
aacgccgcccgggaaccggaaattgttgatttggccaacttctgccgttccatgggagcc
caaatccggggggatggttctagccgcattattatcaacggggtggaaaaactccacagc
accgactttcccattattcctgatcgcattgaggccgctacgttcctctgtgccggggcc
atcacccattccgaaattagtcttttccctgtggtgccagatcacctcgcctccgccatt
gccaagttgcgggaaattggccccgaagtggcgatcgatgccccggatcgggtgcgtttg
attccccgggatctgcgggggacagatatcgaaactttgccttaccccggttttcccacc
gatatgcaagcccaattcatggccctgttggcagtgagtgagggtaatagcgtagtcacg
gaaaccgtatttgaaaaccgtctccagcacgtagcggagttacagcggatgggggccaac
attaagctcaaaggtaatgccgcctttatccaaggagtgcctttcctttccggtgcgccg
gtcatgtccacggatttacgagcttcggcggccctggtaattgcggggttagcggcggaa
ggcaaaaccattgtccaaggtctgcgccatttagaccggggttatgaggacattgaaggc
aaactgcgcaaactgggggctaagttaaccaggattgaacagcccgtcactctttaa

DBGET integrated database retrieval system