KEGG   Synechocystis sp. PCC 6803 PCC-P: SYNPCCP_2805Help
Entry
SYNPCCP_2805      CDS       T01891                                 

Gene name
pfkA
Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
syq  Synechocystis sp. PCC 6803 PCC-P
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:syq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SYNPCCP_2805 (pfkA)
   01230 Biosynthesis of amino acids
    SYNPCCP_2805 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYNPCCP_2805 (pfkA)
   00030 Pentose phosphate pathway
    SYNPCCP_2805 (pfkA)
   00051 Fructose and mannose metabolism
    SYNPCCP_2805 (pfkA)
   00052 Galactose metabolism
    SYNPCCP_2805 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    SYNPCCP_2805 (pfkA)
Enzymes [BR:syq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SYNPCCP_2805 (pfkA)
Protein phosphatases and associated proteins [BR:syq01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SYNPCCP_2805 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3122873..3124027)
Genome map
AA seq 384 aa AA seqDB search
MGTKRIGILTSGGDCPGLNAVIRAVVKASALKGWEVYGIPYGTDGFVEVAHGKYQAEDLL
LTKHGYALPGMLKGLDVLQFLSGSVLGSLSKGHPEQPAIAEAILKGYAILDLEALIVIGG
DGSLDIIYDLAQKGNWHIIAIPKTIDNDVPFTDLAVGFSTAVDIVTQALYDLTFTAASHE
RIIIVQVMGRDAGHLTLHAGIAGGADIILIPEITPCLTSEIIRNCCYQLMNLRKSGRHFA
LIVISEGVHDQNNKKNKHIADYLAEEISETSQHLCDIKDPAFCDLISLDIRATTLGHLQR
SGTPLSFDRLLATVFGIRAVELIEQEIYDQVVIWRSGKVEHADLKPIISIIKECHQENRC
PFPVDRDGFMVKTAKSLGIYLGED
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgggcacaaaacgtattggaattttgaccagtggtggtgattgtcctggcctcaatgcc
gtcatccgagcagtggttaaggcctcagctcttaaggggtgggaggtttatggtattccc
tacggcaccgatggttttgttgaagttgcccacggaaaataccaggcagaggatttactg
ttaactaaacatggctatgctctgcccgggatgctcaaaggcttagatgtattgcaattt
ctcagcggtagtgttttagggtccttaagtaagggacatccagagcaaccggcgatcgcc
gaagccattctcaagggttatgccatacttgacctggaagcactaattgttattggtggc
gatggtagtttagacattatttatgatttagcccaaaaaggtaattggcatattattgcc
attcccaaaaccattgacaatgatgtgccctttacggatctggcagtgggatttagcact
gcggtggatattgttacccaagccttatacgacctgacttttaccgccgctagccatgaa
cgcattatcattgtccaggtcatggggcgggatgcggggcatttgactctccatgcaggc
attgccggcggagctgatatcattttaattcccgaaattaccccttgtttgacttctgaa
attatccgcaattgttgttatcaactaatgaatttgcggaagtctggccgccattttgct
ttaatagttatttcagagggtgtccacgatcaaaataataagaaaaataaacatatcgcc
gactacttagcagaagaaatcagtgaaaccagtcaacacctttgcgacattaaagatccc
gctttttgcgatctaataagtctagacattcgagccacaaccctgggtcatttacaacgg
agcgggacccccctatcgttcgatcgcctcttggccacggtgtttggaattagggcagtg
gagttgatcgaacaggaaatttatgaccaggtggtgatctggcgcagtgggaaggtggaa
cacgctgaccttaaaccaattatcagcatcattaaagaatgtcaccaggaaaatcgctgt
cctttcccggtggatagggatggttttatggttaaaacggccaagtcattgggcatatac
ctaggagaagactaa

DBGET integrated database retrieval system