KEGG   Synechocystis sp. PCC 6803 PCC-P: SYNPCCP_2897Help
Entry
SYNPCCP_2897      CDS       T01891                                 

Gene name
cysQ
Definition
ammonium transport protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
syq  Synechocystis sp. PCC 6803 PCC-P
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:syq00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SYNPCCP_2897 (cysQ)
Enzymes [BR:syq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     SYNPCCP_2897 (cysQ)
Transfer RNA biogenesis [BR:syq03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    SYNPCCP_2897 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3236701..3237576)
Genome map
AA seq 291 aa AA seqDB search
MVISELLPNLDSGLTTLRTAGWGAMEILQSYYSGQNQTNLNANEDKQDGPVTAADLAANQ
YILATLQATFNPEEFGYLSEETHQGNEPLPQDWVWIIDPLDGTRDFIDKTGEYALHIALT
YRQRPVLALVGMPEAQKLYYAIQGQGCFRETKAGAITPVKVKPKTELESLTLVVSRSHRD
QRFQDLIDRLPFGDRHYVGSVGCKIVTILEGQSDVYISLSGKSAAKDWDFAAPELILTEA
GGEFTYFDQTPVLYNRGDVRQWGGILASNGSHHGALCEQAVEILAELDQNN
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggtcataagcgagcttttacccaacctagattccggcttaactactctccgcaccgcc
ggctggggcgcaatggaaattcttcagtcctactacagtggccagaatcagaccaattta
aatgccaacgaagataaacaggatggccccgtaacagcggcggatttggcggccaatcaa
tatattttggctactttgcaagctacctttaacccggaagaatttggctatctaagcgaa
gaaacccaccagggcaacgaaccattaccccaggattgggtttggattattgaccccctc
gatggcaccagggacttcattgataaaaccggggaatatgccctgcatattgctttgacc
tatcgccagcggccggtgttggccctagtgggcatgccggaagcccaaaagctttactat
gccatccaaggtcagggctgttttcgagaaaccaaagccggggcaataaccccagtgaag
gtgaagcctaaaactgaattagaatctttaaccctagtagtgagccgtagccatcgggac
caacgtttccaagatttgattgaccgtttaccctttggcgatcgccattatgtgggcagt
gtgggctgtaaaatcgtcacgattttggagggacagagcgatgtgtacatttccctctcc
ggtaaatccgccgctaaggattgggactttgcggccccggagttgattctcaccgaagcg
gggggagagtttacctattttgaccagacccctgtgttgtataaccggggcgacgtgcgg
caatggggcggtatcctggctagcaatggttcccaccatggagctttgtgtgagcaagcc
gtggaaattttagctgaactagatcaaaataattaa

DBGET integrated database retrieval system