KEGG   Synechococcus sp. RCC307: SynRCC307_0096Help
Entry
SynRCC307_0096    CDS       T00523                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
syr  Synechococcus sp. RCC307
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:syr00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:syr00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(93817..94287)
Genome map
AA seq 156 aa AA seqDB search
MALSLNGVSVTSADGSSRDLATDNGSVLLIVNVASQCGFTKQYAGLQQLHERYGKQGLKV
IGFPCNDFGAQEPGTIEEIKTFCSSNYGVSFELMSKVASDAAPFDTLTQADPAGPIAWNF
EKFLVGKDGGVIARFKSGVEPESSELTTAIETALAA
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atggccctcagcctcaacggcgtcagcgtgacctcagccgatggatccagccgtgatctg
gccaccgacaacggcagcgtcctgctgatcgtgaatgtggccagccagtgcgggttcacc
aagcaatacgccggactgcaacagctccatgagcgctacggcaagcagggcctcaaggtg
attggcttcccttgcaatgactttggcgcccaagagcccggcacgatcgaagagatcaaa
accttctgctccagcaactacggcgtcagctttgagctgatgagcaaggtggcctctgac
gctgccccctttgacaccctgactcaagccgaccccgctggcccgatcgcctggaatttc
gagaaattcctggtgggcaaagacggaggggtgatcgcccgctttaaaagcggcgttgag
ccggagagcagtgagctgactacggcgattgagacggccttggccgcctga

DBGET integrated database retrieval system