KEGG   Synechococcus sp. RCC307: SynRCC307_0096Help
Entry
SynRCC307_0096    CDS       T00523                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
syr  Synechococcus sp. RCC307
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:syr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SynRCC307_0096
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SynRCC307_0096
Enzymes [BR:syr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SynRCC307_0096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(93817..94287)
Genome map
AA seq 156 aa AA seqDB search
MALSLNGVSVTSADGSSRDLATDNGSVLLIVNVASQCGFTKQYAGLQQLHERYGKQGLKV
IGFPCNDFGAQEPGTIEEIKTFCSSNYGVSFELMSKVASDAAPFDTLTQADPAGPIAWNF
EKFLVGKDGGVIARFKSGVEPESSELTTAIETALAA
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atggccctcagcctcaacggcgtcagcgtgacctcagccgatggatccagccgtgatctg
gccaccgacaacggcagcgtcctgctgatcgtgaatgtggccagccagtgcgggttcacc
aagcaatacgccggactgcaacagctccatgagcgctacggcaagcagggcctcaaggtg
attggcttcccttgcaatgactttggcgcccaagagcccggcacgatcgaagagatcaaa
accttctgctccagcaactacggcgtcagctttgagctgatgagcaaggtggcctctgac
gctgccccctttgacaccctgactcaagccgaccccgctggcccgatcgcctggaatttc
gagaaattcctggtgggcaaagacggaggggtgatcgcccgctttaaaagcggcgttgag
ccggagagcagtgagctgactacggcgattgagacggccttggccgcctga

DBGET integrated database retrieval system