KEGG   Synechococcus sp. RCC307: SynRCC307_0209Help
Entry
SynRCC307_0209    CDS       T00523                                 

Gene name
psbF
Definition
(GenBank) Cytochrome b559 beta subunit (PSII reaction center subunit VI)
  KO
K02708  
photosystem II cytochrome b559 subunit beta
Organism
syr  Synechococcus sp. RCC307
Pathway
Photosynthesis
Metabolic pathways
Module
Photosystem II
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:syr00001]
 Metabolism
  Energy metabolism
   00195 Photosynthesis
    SynRCC307_0209 (psbF)
Photosynthesis proteins [BR:syr00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Main subunits
    SynRCC307_0209 (psbF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(210856..210993)
Genome map
AA seq 45 aa AA seqDB search
MTSTPSPATPRNYPIFTVRWLSLHALGIPTVFFLGALAAMQFVRR
NT seq 138 nt NT seq  +upstreamnt  +downstreamnt
atgacttccactccttcacccgcaacaccccgcaactatccgatcttcacggtgcggtgg
ctatcgcttcacgccctcggcattccaacggtgtttttcttgggcgctctggcggccatg
cagttcgttcgtcgctaa

DBGET integrated database retrieval system