KEGG   Synechococcus sp. RCC307: SynRCC307_0221Help
Entry
SynRCC307_0221    CDS       T00523                                 

Gene name
chlD
Definition
protoporphyrin IX Mg-chelatase subunit ChlD (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
syr  Synechococcus sp. RCC307
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SynRCC307_0221 (chlD)
Enzymes [BR:syr01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     SynRCC307_0221 (chlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(219817..221778)
Genome map
AA seq 653 aa AA seqDB search
MLPVFPLAAVTGHPTLKLALLLAAIDPGLGGVVIAGGRGTGKSVLARGLHALLPAIEILE
GSWNEEPDGVNPSKVIPAPFVQIPLGVTEDRLVGSVDVTRSLSEGRTVFQPGLLAEAHRG
VLYIDELNLLDANALNLVLAAVGSGTNQVEREGLSVAHPCRPLLIATYNPEEGAVRDHLL
DRFAIALSADQTIDSASRVSIAEAAIAYGENAEAFRAQFQEETDALATQLLLARQWLPDV
QISREQIAYLVNEALRGGVEGHRAELYALRVARAHAALQGRDQVEAEDLQLAVRLVIAPR
AKLMPPPDDQQQPPPPPPPPPGDNEEQPDPPESEDNNEEEEPDPPEPDEPEDDTPPSVPE
EFMLDAEATAIDPELLQFQSAKNRAASSGSRGIVLSESRGRYVRPVLPRGPVRRIAVDAT
LRAAAPYQKARRAREPHRKVIVQDGDLRAKQLQRKAGALVIFLVDASGSMALNRMQSAKG
AVLRLLTEAYENRDEVALIPFRGEQAEVLLPPTRSITAAKRRLETMACGGGSPLAHGLAQ
AARVGNNALQTGELSQVVVVAITDGRGNVPLGRSLGQPELEGEPPVDLKQELKDVASRYA
QLGLQLLVIDTERKFIGSGMGKELAAAAAGRYVQLPKASDQAIAAVALEALNR
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgcttcctgtttttcccctcgctgccgtcaccggccacccaacgctgaagctggcgctg
ctgctggcggcgattgacccaggcctgggtggtgtggtgattgctggggggcgcggcaca
ggcaaatcagtgctggccaggggcctgcacgccttgctgccagccatcgaaattcttgaa
ggcagctggaacgaagaaccagatggggtcaaccccagcaaggtgatccctgcaccgttt
gtgcagatcccacttggggtcaccgaagaccgactggtgggctccgttgatgtcacccgc
tcgctctcggaagggcgaaccgtgtttcaacccggactcctcgctgaagcccacagaggg
gtgctttacatcgatgagctcaacctgctcgatgccaatgccttgaacctggtgttggcg
gctgtgggctcaggcaccaaccaggtggagcgcgaaggcctgagcgtggcccatccctgc
cggccgctgctcattgccacctacaacccagaggaaggtgctgttcgcgatcacctgctg
gatcgcttcgcgattgccctttccgctgatcagaccatcgacagcgcatcccgcgtcagc
atcgccgaggctgccattgcctacggcgaaaacgctgaggcatttcgggcccaatttcaa
gaagaaaccgatgccctcgccacccagctgctgctagcgcggcaatggctacccgatgtg
caaatcagccgcgaacagatcgcctacttggtgaatgaagcgctgcgcggcggtgtggaa
ggccaccgggctgagctctatgccctgcgcgtggcccgagcccatgccgctttgcaaggc
cgcgatcaagtggaagccgaagacctgcaattggccgtgcggctggtgatcgcaccacgg
gccaagttgatgcctccgccggatgatcagcaacaacctcctcctcccccgccgccgcca
ccgggcgataacgaagagcaaccggatccgcctgaaagcgaggacaacaacgaagaggaa
gagcccgatccacccgagcccgatgagccggaagacgacactccgccgagcgtgccggag
gagttcatgctcgatgcggaagccaccgcgatcgacccagaactgctgcagttccaaagc
gccaaaaaccgggccgccagtagtggctcgcgcggcattgtgctgagcgaaagccgcggc
cgttatgtgcggcctgtgcttccccgcggaccggttcgccgtattgccgtcgacgccacc
ctgcgcgcagctgccccctatcaaaaagctcggcgcgcgcgcgaaccccaccggaaggtg
atcgttcaagacggcgatctgcgcgcgaagcaactgcaacgcaaagcaggcgccctggtg
atcttcctggtggatgccagcggctcgatggcgctgaaccgcatgcaaagcgccaagggt
gctgtgcttcggctactcactgaggcctatgaaaaccgcgatgaggtggccctgatcccc
ttccggggcgagcaagctgaagtgctgcttcctcccacccggtcgattacggcggccaaa
cggcgcttagaaaccatggcctgcggaggcggcagtcctctcgcccatggcctagcccaa
gcagcgcgagtcgggaacaacgcgctgcaaaccggtgagttatcgcaagtggtggtggtc
gccatcaccgacggcagaggcaatgtgccgctcggccgctcattgggccaacccgaactt
gaaggtgagccgcctgttgatctcaagcaagagctcaaggacgtggcgagccgatacgcg
caactgggcttgcagctgctggtgatcgacaccgagcgcaagttcattggcagcggcatg
ggcaaagaactcgccgccgccgccgctggccgctacgtgcaactacccaaagccagcgat
caggcgattgcagcggttgcccttgaggccttaaaccgctga

DBGET integrated database retrieval system