KEGG   Synechococcus sp. RCC307: SynRCC307_0223Help
Entry
SynRCC307_0223    CDS       T00523                                 

Gene name
folK
Definition
(GenBank) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridinepyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
syr  Synechococcus sp. RCC307
Pathway
syr00790  Folate biosynthesis
syr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SynRCC307_0223 (folK)
Enzymes [BR:syr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     SynRCC307_0223 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK
Motif
Other DBs
NCBI-ProteinID: CAK27126
CyanoBase: SynRCC307_0223
CYORF: SynRCC307_0223
UniProt: A5GQG7
Position
224187..224717
Genome map
AA seq 176 aa AA seqDB search
MPLCRKTSAVALGSNLGDSLELLSTAAQALQQLAAAGSFRCSPLFRTAPVGGPVDQPDFI
NAVVLLDWQDTPEQLLQQLQQLEAAAGRQRLIANGPRSLDLDLLWCGMEQRCSAFLELPH
PRLAQRRFVLQPLAALDPTLVPPGQGLSVSALLARVEQLGEEPPPEQLQFPHSWPG
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgccgttgtgccgcaaaaccagtgcggtggcgttgggcagcaacctgggtgattcgttg
gagctgctgagcacagcggcccaggccctgcagcagttggccgcggcaggttcgtttcgc
tgctcgccgctgttccgcaccgctccagtgggcgggccggtggaccagcctgacttcatc
aatgcggtggtgctgctggattggcaggacactcctgagcaattgcttcagcagctgcag
cagctggaggccgctgctggccggcagcgcttgatcgccaatggcccgcgctcattggat
ctcgatttgctctggtgcggcatggagcaacgctgcagcgctttcctcgagctgccccat
ccgcgcttggcccagcgccgttttgtgctgcagcccttggcggcgctggatccaacgttg
gtgccgccagggcagggtctcagtgtttcagctttgctggcgcgggttgagcaactgggc
gaggagccgccgccagagcagcttcaattcccccacagctggcccggttga

DBGET integrated database retrieval system