KEGG   Synechococcus sp. RCC307: SynRCC307_0278Help
Entry
SynRCC307_0278    CDS       T00523                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
syr  Synechococcus sp. RCC307
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SynRCC307_0278 (hemD)
Enzymes [BR:syr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     SynRCC307_0278 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(278653..279441)
Genome map
AA seq 262 aa AA seqDB search
MPPDLSGHTVVLTRAEHQLGAARKLFEAAGAQVLDLPALVIGPPDSWGPLDDALSELEDF
HWLVVSSANGVTAVDERLQAQGRSLARRPASLKIAAVGRKTAQQLEDLGATADFIPPDFV
ADSLLENFPVGVWGQRILLPRVQSGGRTLLAEAFGEAGARVSEVAAYESRCPKDLPALTA
AALEAGMAEAICFSSGKTVRHTVQLLEAQFGESWNEHISRLAVISIGPQTSAVCRELLGH
VDAEADPHDLDGLVAACSRALA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgccgcctgatctgagcggccacaccgtggtgctcacccgcgcggagcaccagctgggg
gctgcgcgaaagctgtttgaagccgctggcgcccaggtgctggatttaccagcgctggtg
attggcccgcccgatagctgggggcctttggatgatgccctcagcgaactggaggacttc
cattggctggtggtctccagcgccaatggcgtcaccgcggtggatgaacggctgcaagcc
caaggccgcagcctggctcggcggccagcgtcgctaaaaatcgctgcggtgggccgcaaa
acggctcagcaactggaggatctcggcgcaaccgccgatttcatcccaccggatttcgtg
gccgacagcctgctggagaacttccctgttggcgtctggggccagcggatccttttgccg
cgggtgcaaagcggcggacgcacgctgctggctgaagcctttggcgaagccggcgcgcgg
gtgagcgaagtggcggcctatgaatcgcgctgccccaaggatctgccagccctcaccgcc
gctgctctagaagccggcatggcggaggccatctgtttcagcagcggcaaaaccgtgcgc
cacacggtgcaactgctcgaggcccagttcggcgagagctggaacgagcacatcagcagg
ctggcggtgatttcgattggcccgcaaaccagcgccgtttgccgggagctgctggggcac
gtcgacgctgaagctgatccccatgaccttgatggcctggtagccgcctgcagccgcgcc
ttggcttaa

DBGET integrated database retrieval system