KEGG   Synechococcus sp. RCC307: SynRCC307_0542Help
Entry
SynRCC307_0542    CDS       T00523                                 

Gene name
cysQ
Definition
3'-phosphoadenosine 5'-phosphosulfate (PAPS) 3'-phosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
syr  Synechococcus sp. RCC307
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:syr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SynRCC307_0542 (cysQ)
Enzymes [BR:syr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     SynRCC307_0542 (cysQ)
Transfer RNA biogenesis [BR:syr03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    SynRCC307_0542 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
478440..479357
Genome map
AA seq 305 aa AA seqDB search
MALACDQSMMPTTEAILVVLRRLVWESADILRAYARSEQPPFGYPPALSVDNGGEGPVSA
ADLAVNQHLLDGFRSNFPDAPWALLSEETAAEQLTAGVPLDAEWLWILDPLDGTKDFLQG
TGEYAVHLALVHHQRPVLGVVLQPEREEVWFGLVDEQKAWCETRDGTQRPAQLSSRVQRS
DLVLVASRNHRDERLERLLEALALGDTKAIGSVGGKVATILRGETDVYISLSGRSAPKDW
DMAAPEAVLLAAGGAFSHADGAPLLYNDGDVRQAGCLIASNGKAQAELCELARACLAEID
PGFAV
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcgcctgtgatcaatccatgatgcccaccaccgaagccatccttgtggtactg
cggcgtttggtttgggagtcggccgatatcctgcgggcctatgcccgctccgagcagcct
ccctttggctatccccccgccttgagtgtggataacggcggcgaaggcccggtgagcgcg
gcggatctggcggtgaatcaacacctgctcgatggctttcgcagcaacttcccggatgcc
ccctgggctctgctcagcgaagaaaccgctgcggagcagctcaccgctggtgttccgctg
gatgccgaatggctgtggatcctcgatccgctcgatggcaccaaggatttcctgcagggc
accggcgagtacgccgtgcacttggcgttagtgcaccaccaacggccggtgctgggggtg
gtgctccagcccgagcgggaagaggtgtggtttggcctggtggatgaacagaaggcctgg
tgtgaaacccgcgatggcacgcagcgccccgcccagctcagcagccgcgtccagcgctcc
gatttggtgttggtggcgagccgcaaccaccgcgatgagcgactcgagcgtttgctggag
gcgttggctttgggcgacaccaaggcgattggcagtgtcggcggcaaggtggccacgatc
ctgcgtggggagaccgatgtctacatctccctgtcgggccgcagcgccccgaaggattgg
gacatggcggctccagaagcggtgctgctggctgcgggcggtgccttcagccacgccgat
ggcgcgcccttgctgtacaacgacggcgatgtgcgccaagccggctgcctgatcgccagc
aatggaaaagcccaggccgagctctgtgagctggcccgggcttgcctggctgagattgat
ccaggctttgcggtttag

DBGET integrated database retrieval system