KEGG   Synechococcus sp. RCC307: SynRCC307_0616Help
Entry
SynRCC307_0616    CDS       T00523                                 

Gene name
trpC
Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
syr  Synechococcus sp. RCC307
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:syr01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:syr00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
550132..551016
Genome map
AA seq 294 aa AA seqDB search
MEIRRRPPNPKVRVAHLEYAVPHDDEAPRHILEEIVWEKDREVAQARERVPLEKLKSQVA
ALPAPRDFVAALKASCRKPAVIAEVKKASPSKGVIREDFDPEAIAKAYAEGGASCLSVLT
DKRFFQGGFEVLVQVRQVVDLPLLCKEFILSPYQLYQARAAGADAVLLIAAILTDQDISY
LLKVARSLGLQVLLEVHDAAELERALGFEGVQLIGINNRDLTSFDTDLATTETLTATYGE
QLRQSGALLVSESGLFSRDDLDRVQSAGADAVLVGEALMRQSDVQQALETLISG
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggaaatccgtcgccggccgcccaaccccaaggtgcgtgtggcccatctggaatacgcc
gtcccccacgacgatgaggccccgcgccacatccttgaggagatcgtttgggagaaagac
cgcgaagtcgcccaggcccgtgagcgggtgccactggagaagctgaaatcccaggtggcg
gccttgccggcgccccgtgatttcgtcgctgcgttgaaggccagctgccgtaagccggca
gtgattgctgaggtgaaaaaggctagccccagcaaaggggtaatccgcgaagactttgac
cccgaggccatcgccaaggcctatgccgaaggtggagccagctgcttgtcggtgctcacc
gacaagcgctttttccaaggtggttttgaggtgctggtgcaggtgcgccaggtggtggat
ttgcccctgctctgcaaggagttcatcctcagcccctatcagctgtatcaggcccgcgcc
gctggcgctgatgcggtgctgttgattgcagcgatcctcaccgatcaagacatcagctat
ctgctcaaagtggcccgcagccttggtttgcaggtgctgctggaagtgcatgacgccgct
gagctggagcgtgcgctcggctttgagggcgtgcagctgatcggcatcaacaaccgcgat
ctcaccagttttgacaccgatttggcgacaacagaaacgctgacggctacctacggcgag
cagttacgtcaaagcggcgcgctgctggtgagtgaatcgggtttgttcagtcgtgatgat
ctcgatcgggtgcagagcgctggggccgatgcggtgctggtgggtgaggccttaatgcgc
caaagcgatgtacagcaggccctggaaacgttgattagcggttga

DBGET integrated database retrieval system