KEGG   Synechococcus sp. RCC307: SynRCC307_0801Help
Entry
SynRCC307_0801    CDS       T00523                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
syr  Synechococcus sp. RCC307
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:syr03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(731301..731948)
Genome map
AA seq 215 aa AA seqDB search
MWRDDLPRFQPSHCRPLTVFTRPLARLIEQFERLPGIGPRTAQRLALHLLRQPEEQSRAF
ADALLAARQQVGQCQRCGHLSADPICDICRNPERNIGVICVVADSRDLLALERTREFSGS
YHVLGGLISPMDGIGPEALGIQPLLQRLDPEQVEEVILALTPSVEGDTTSLYLARLLKPF
CRVTRIAYGLPVGSELEYADDVTLARALEGRRIVE
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
ttgtggcgtgatgacctgcctagatttcagccaagccattgcaggccgctgactgtcttc
acccgaccactggcccggctgatcgagcaattcgagcgcttgcccggcatcggcccgcgc
acggcccagcgactggccctccatttattgcgccaacccgaggagcagagccgcgccttt
gccgatgccctcttggcagcgcgccagcaagtaggccaatgccaacgctgcggccacctc
tcggccgatccgatttgcgacatctgccgcaaccccgagcggaacattggcgtgatctgc
gtggtggccgattcccgcgacctgctggcgctggagcgcacccgtgagttttccggcagc
taccacgtgctgggcggattgatttcaccgatggatggcattggtcctgaagctttgggc
atccaaccgctgctgcagaggctggatcctgagcaggtcgaggaagtcatcctggcgctg
acccccagcgtggagggagacaccaccagcctgtatctggcgcgcctactcaagcccttc
tgccgggtgacccgcatcgcctatggactgccggtgggaagtgagctggaatacgccgat
gatgtgaccctggctcgggcccttgaagggcgccggattgtggagtga

DBGET integrated database retrieval system