KEGG   Synechococcus sp. RCC307: SynRCC307_0920Help
Entry
SynRCC307_0920    CDS       T00523                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
syr  Synechococcus sp. RCC307
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:syr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SynRCC307_0920
Enzymes [BR:syr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SynRCC307_0920
Exosome [BR:syr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SynRCC307_0920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(841625..843943)
Genome map
AA seq 772 aa AA seqDB search
MALATLDWMSKDAERLAQCNHDHPQAVLGPQQLEDGRWVVRVWMPEASRVVLLHQGHEHA
LENPHHAWIFEGELSSNPGSQYRLRVERAGITHEQHDPYAFRQEWMGAMDRHLFAEGNHH
HIWQRMGAHPHLQDGVAGVQFCLWAPNARSVSVIGDCTNWDGRHLPMQQRIGGIWELFVP
GLGAGAHYKYEIHTQQGHCYEKADPYGFQHEVRPAQASVVASLKGYQWGDDAWLKQRDNR
NPLEQPVSVYEMHMGSWMHGSWDEPYIEADGTPRAPVPAADLKPGARLLTYPELADRVIP
YVKARGFTHIELMPMAEHPFDGSWGYQVTGFYAPTSRFGTLDEFRAFVDRCHAEGIGVIL
DWVPGHFPKDAHGLAFFDGSHLYEHGDPRIGEHKEWGTLIFNYSRNEVRNFLVANLVFWF
EELHIDGIRVDAVASMLYRDYLRPDGEWIANEHGGRENLEAVRFLQQANSVLFHYFPGAL
SIAEESTTWPLVTMPTSMGGLGFNLKWNMGWMHDMLDYFELDHWFRQFHQNNITFSIWYA
HTENFMLALSHDEVVHGKSHLLHKMPGSDELKFANVRALLTYMWTHPGKKTIFMGMEFAQ
RGEWNVWGDLEWDKLQFPEHQGVVNLVDDLNALYKSEPALWRNDFDSFGFQWIDCDDTNH
SVVSFMRRDEKEGNWVVVVCNFTPEGHGNYRIGVPVDGFYTELFNSDGARYGGSNQGNLG
GKFSDDWGMHSYGQSLDLCLPPLTVMVFKHDPNRQREAAKDEAAAKLGGSLG
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atggctctggcaaccctcgattggatgagcaaggacgcggaacgcctggcccagtgcaat
cacgaccatccccaagcggtgcttggcccgcaacaactcgaagacggccgctgggtggtg
agggtttggatgcccgaggcctcccgcgtggtgctgttgcaccaaggccatgaacatgct
ctggaaaacccgcatcacgcttggatctttgaaggcgaactgagcagcaatcccggatcc
caataccgcctgcgcgtcgagcgcgccgggatcacccacgagcagcacgacccctatgcc
ttccgccaggagtggatgggagccatggaccggcacctgttcgccgaaggcaatcaccac
cacatctggcagcgaatgggggcccacccccacctgcaagacggtgttgcaggagtgcag
ttctgcctgtgggctcccaacgcccgcagcgtttcggtgattggcgactgcaccaactgg
gatggccgccacctgccgatgcagcagcggatcggcggcatctgggaactgtttgtgcct
ggactcggtgcaggcgcccactacaaatacgaaatccacacccaacagggacactgctac
gagaaagccgacccctacggcttccagcacgaagtgcgcccagcccaagcctcggtggtg
gccagcctcaagggctatcagtggggcgatgacgcctggctgaagcagcgcgacaaccgc
aacccgctcgagcagcccgtctcggtgtacgagatgcacatgggcagctggatgcatggc
agctgggatgagccctacatcgaggccgatggcacccccagagcgcctgtaccggctgcc
gatctcaagccaggcgcccgcctgctgacctacccggaactcgccgatcgggtgattcct
tatgtgaaagcacgcggcttcacgcacatcgagctgatgccgatggcggagcaccccttt
gatggctcctggggctatcaggtgacgggcttttatgcccccaccagccgctttggcacc
ctcgacgaattccgcgcctttgtggaccgctgccatgccgaaggcattggcgtgatcctc
gattgggtgcccgggcacttccccaaagacgcccatggcttggccttttttgatggcagc
cacctctatgagcacggtgatccgcgaatcggcgagcacaaggagtggggcacgctgatc
ttcaactacagccgcaatgaggtgcgcaacttcctggttgccaacctcgtcttctggttt
gaagaactccacatcgacggcattcgcgtcgatgccgtggcttcgatgctctaccgcgac
tacctacgccccgatggcgaatggatcgccaacgagcatggcggccgcgaaaacctagaa
gccgtgcgcttcctgcagcaggccaattcggtgctgttccactacttccctggcgcgctc
tccattgccgaggaatcgaccacctggcccctggtgaccatgcccacctcgatgggtggc
ttgggtttcaacctcaagtggaacatgggctggatgcacgacatgctcgattacttcgag
ctggatcactggttccgccagttccaccagaacaacatcaccttctcgatctggtacgcc
cacaccgagaacttcatgctcgccctcagccacgacgaagtcgtgcatggcaagagccat
ctgctgcacaagatgcccggcagcgatgaactcaaattcgccaatgtgcgggcgctgctc
acctacatgtggacgcacccgggcaagaagaccatcttcatgggaatggaattcgcccaa
cggggcgaatggaatgtctggggtgatctggagtgggacaagctccaattccccgagcac
cagggtgtggtgaatctggtggatgacctcaacgcgctctacaaatcagagccagcgctg
tggcgcaacgacttcgatagtttcggcttccagtggattgattgcgacgacaccaaccac
agcgtggtgagcttcatgcgccgcgacgagaaggaaggcaattgggttgtggtggtctgc
aacttcacccccgaaggccatggcaactaccgcattggtgtgccggtcgatggcttctac
accgagctgttcaacagtgatggcgcccgttatggcggcagcaaccagggcaatctcggc
ggcaaattcagcgacgactggggcatgcacagctatgggcaatccctcgatctctgccta
cctccattgaccgtgatggtgttcaaacacgacccgaaccggcaacgagaagcagcaaag
gatgaagctgcagccaaattgggcggatccctcgggtag

DBGET integrated database retrieval system