KEGG   Synechococcus sp. RCC307: SynRCC307_0925Help
Entry
SynRCC307_0925    CDS       T00523                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
syr  Synechococcus sp. RCC307
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:syr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SynRCC307_0925
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SynRCC307_0925
   00052 Galactose metabolism
    SynRCC307_0925
   00500 Starch and sucrose metabolism
    SynRCC307_0925
   00520 Amino sugar and nucleotide sugar metabolism
    SynRCC307_0925
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SynRCC307_0925
   00524 Butirosin and neomycin biosynthesis
    SynRCC307_0925
Enzymes [BR:syr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SynRCC307_0925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
850655..851572
Genome map
AA seq 305 aa AA seqDB search
MVVMAKPHRQVIGVDIGGTGLKLGRFDSDGQLLAEQLCPTPQPPAPGAITTALVEAIEAL
DPERQADAVGVGLPGPMDRSARVAQVCINLPGWQHVPLAEWLEARLQRPVTLANDGNCAV
LGEQWLGAAKGIDDVVLLTLGTGVGGGVILGGQLFLGRRGAAAEPGLIGLDPAGPPCNSG
NNGSIETFCSIGALTRWAGCPPDELSRRATNGDAEALEAWQRYGQLLGCGISSLVYAFTP
ERVLLGGGLSAAFPFFAGSLQQEVESRVLAPSRQDLVIAPASLGNGAGRLGAARLALERL
PGRQG
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtggtggtgatggcgaagccgcaccgtcaggtgatcggggtggatatcggtggcactggc
ctcaagctgggtcgttttgatagcgacggccagctcttggcggagcagctctgcccgaca
ccccaaccacccgcccccggtgccatcacaacggcgctggtggaagccattgaggccctt
gatccagagcgtcaagccgatgcggttggtgtggggctgcccggcccgatggaccgcagc
gcccgggtggctcaggtctgcatcaatctcccgggttggcagcacgttccgttggccgag
tggctggaggcacgcctgcagcgcccggtcacgttggccaacgatggcaattgcgctgtg
ctcggtgagcagtggcttggcgctgccaaaggaatcgatgacgtggtgctgttgaccctg
ggcaccggcgttggtggcggggtgatccttggcggccagctctttcttggtcgccgcggt
gctgccgctgaacctggattgattggcctggatccggcaggcccgccatgcaacagcggc
aacaacggttcgatcgagacgttttgcagcattggtgccctcacccgttgggctggctgc
ccccccgatgagctctccaggcgcgccacaaacggcgatgcggaagcccttgaggcttgg
cagcgctatggccagcttttgggctgcggcatcagctcgttggtctatgccttcaccccc
gagcgcgtgttgttggggggcggcctcagcgctgcatttcccttttttgccggcagtctt
cagcaggaggtggagagccgagtgctggctccaagccgccaggatctggtgattgcaccg
gccagcttgggcaatggggctggccgcttgggcgcggctcgcttggcgttggagcgtctg
ccaggccgccagggatga

DBGET integrated database retrieval system