KEGG   Synechococcus sp. RCC307: SynRCC307_0944Help
Entry
SynRCC307_0944    CDS       T00523                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
syr  Synechococcus sp. RCC307
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:syr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SynRCC307_0944 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SynRCC307_0944 (glk)
   00052 Galactose metabolism
    SynRCC307_0944 (glk)
   00500 Starch and sucrose metabolism
    SynRCC307_0944 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    SynRCC307_0944 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SynRCC307_0944 (glk)
   00524 Butirosin and neomycin biosynthesis
    SynRCC307_0944 (glk)
Enzymes [BR:syr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SynRCC307_0944 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(866645..867688)
Genome map
AA seq 347 aa AA seqDB search
MTLLLAGDLGGTKTLLALYRSDGDQLSCVARERYISAEWPHLGPMLQRFLADHNNNGAEV
AAGCIAVAGPVRQGRAHITNLPWDLEQSALAADGGLNQLELVNDFAVLVYGLPHLSEEQQ
VVLQEGEADPQGPIAILGAGTGLGMASGVRLSNGALMTLPSEGGHREFPPRNAEEMLMLG
WLRRELQLERLSVERIVSGTGLGLVFLWLLHCGGDQPISDLHQAAMDWHQQAPGTPGRPD
LPALVSQRARDGDMLASKAEQIWLGAYGSAAGDLALQTLSTGGLWVGGGTAIKQLERLQS
DAFLAPMRCKGRFEDFINKLPVRALVDPDAGLFSAACRARMLAGCLQ
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgctgctagcgggtgatctgggcggaaccaaaaccttgctggcgttgtatcgc
agcgacggcgatcaactgagctgcgttgcccgcgagcgctacatctcggcggaatggccc
cacctcgggccgatgctgcagcgctttttggccgatcacaacaacaacggcgctgaggtg
gccgcaggctgcatcgccgttgccggaccggtgcgtcaaggacgcgcccacatcaccaac
ttgccctgggatctcgaacaatcagccctggcggccgatgggggactcaaccagctggaa
ctggtgaatgatttcgcggtgttggtctatgggctcccccatctgagcgaggagcagcag
gttgtgctgcaggaaggggaggctgatccccaagggccaatcgccatcctcggcgccggc
acaggcctgggcatggccagcggcgtgcggctcagcaatggcgccttgatgaccctgccg
agcgaaggcggacaccgggaatttccgccccgcaatgccgaggagatgctgatgctcggc
tggttgcggcgcgagttgcagctcgagcggctttcggtggagcgcatcgtcagcggcacc
ggcctgggcctggtgttcctctggctgttgcactgcggcggcgatcaacccatcagcgac
ttgcaccaagccgccatggactggcatcagcaagcccctggcacccccggtcgccccgat
ctgccggccctggtctcgcagcgggcccgtgatggggacatgctggccagcaaagccgag
cagatttggctcggggcctatggctcagcggccggtgatctggcgctgcaaaccctctcc
actggtggcctctgggtgggcggcggcaccgccatcaagcagctggagcggctgcaaagc
gatgcgtttttggcaccgatgcgctgcaaagggcggtttgaagacttcatcaacaagctg
ccggtgcgggccctggtggaccctgatgccggcttattcagcgccgcttgccgtgcgcgc
atgctggcaggatgccttcaataa

DBGET integrated database retrieval system