KEGG   Synechococcus sp. RCC307: SynRCC307_0973Help
Entry
SynRCC307_0973    CDS       T00523                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
syr  Synechococcus sp. RCC307
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SynRCC307_0973
Enzymes [BR:syr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SynRCC307_0973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(892366..893229)
Genome map
AA seq 287 aa AA seqDB search
MTPDHRTAVMGILNITPDSFSDGGRFQSTEQAFRAVKRMAAQGADLIDLGAQSTRPGATD
VGAEIEIERLLPVLKRLQQARRDGDLPAELLFSIDTFLAPVADACLDAGADWINDVSGGL
GDRQMWQVVAKRGCPYVLMHRRGDARTMNSLAHYSDVVAEVKAELLQLCEQAQQAGVQRQ
QLVLDPGIGFAKTTQHNLELMQGLPQLQALGYPLLVGTSRKRFIGEVLNEPRPRARLWGT
AASVCQAVAAGVAVVRVHDVGPIVQTCRMAEALFKPNAASRAPQTLA
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgacgccagatcaccgcaccgcggtgatgggaatcctgaacatcaccccggattccttt
agtgacgggggccgttttcaatccaccgaacaagcgtttcgggccgtcaagcgcatggcc
gcccagggcgcagatctgattgacctcggggcgcaaagcacccgccctggggccaccgat
gtgggagctgagatcgagatcgagcgattgctgccggtgttgaagcgtctgcagcaagcc
cggcgtgatggcgatcttccggccgagttgctgttctccatcgacaccttcctggcaccg
gtggccgatgcctgcctcgatgctggggccgactggatcaacgatgtctccggtggcctt
ggcgatcggcagatgtggcaggtcgtggccaagcgcggctgcccctatgtgctgatgcac
cggcggggcgatgcccgcacgatgaacagcctcgcccactacagcgatgtggttgctgaa
gtgaaagctgagctgctgcaactctgcgagcaggcccaacaggccggcgttcagcgccaa
caacttgtgctggaccccggcattggctttgccaaaaccacccagcacaacctggagctc
atgcagggactgccgcaactgcaagcccttggctacccactgctggtgggcacctcacgc
aaacgtttcatcggcgaggtgttgaacgaacccagaccccgcgcgcgcctttggggaaca
gccgccagtgtttgccaggccgtggccgccggggtggcggtggtgcgggtgcacgatgtt
ggaccgattgttcagacctgccgcatggccgaggccctgttcaagccaaacgccgcaagc
agagctcctcaaacgctggcctga

DBGET integrated database retrieval system