KEGG   Synechococcus sp. RCC307: SynRCC307_0974Help
Entry
SynRCC307_0974    CDS       T00523                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
syr  Synechococcus sp. RCC307
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:syr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SynRCC307_0974 (tpiA)
   01230 Biosynthesis of amino acids
    SynRCC307_0974 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SynRCC307_0974 (tpiA)
   00051 Fructose and mannose metabolism
    SynRCC307_0974 (tpiA)
   00562 Inositol phosphate metabolism
    SynRCC307_0974 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SynRCC307_0974 (tpiA)
Enzymes [BR:syr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SynRCC307_0974 (tpiA)
Exosome [BR:syr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SynRCC307_0974 (tpiA)
  Exosomal proteins of bladder cancer cells
   SynRCC307_0974 (tpiA)
  Exosomal proteins of melanoma cells
   SynRCC307_0974 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(893226..893987)
Genome map
AA seq 253 aa AA seqDB search
MSTQSRPVVIAGNWKMHMTCAQAKQYAAAFLPQVANAPKDRSIVLAPPFTAISTLQEALA
GSDVQIASQNVHWKDSGAFTGEISAEMLLELGVGYTIVGHSEPRKYFSESDEQINQRARA
SQAAGLIPILCVGESDEQRSSNETERVIRRQVEQGLEGIDPSKLVVAYEPIWAIGTGKTC
ESEEANRVCGLIRNWVGYPNLTIQYGGSVKPGNIDELMAKSDIDGVLVGGASLEPDSFAR
IANYQMASAAAAA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtgagcactcagtcccggccggtcgtgatcgccggtaactggaaaatgcacatgacctgt
gctcaagccaagcaatacgccgccgcgttcctgccccaagtggccaatgcccccaaggac
cgcagcatcgtgctggcgccgcccttcacggccatttccacgctgcaagaggccttggct
ggaagcgacgtgcagatcgccagccaaaacgtgcactggaaggactcaggagccttcacc
ggcgagatctctgccgagatgctgctcgaactgggggtgggctacacgatcgtgggccac
agcgaaccgcgtaaatacttctctgagagtgacgagcagatcaaccaacgggctcgcgcc
tcccaagccgctggcttgatccccatcctttgcgtgggggagagcgatgagcagcgcagc
agtaacgaaacagagcgcgtcatccgtcgtcaggtggagcagggactcgaaggcatcgat
ccctccaagctggtggtggcctacgaaccgatctgggccattggcaccggcaaaacctgt
gaatccgaggaagcgaaccgcgtctgcggcttgatccgcaactgggtgggctatcccaat
ctgacgattcagtacggcggctcggtgaaacccggcaacatcgatgagctgatggccaaa
tcggatatcgacggcgtgttggtgggtggcgcttcgctggagcccgatagctttgctcgc
atcgccaactaccagatggccagcgcagctgctgcggcatga

DBGET integrated database retrieval system