KEGG   Synechococcus sp. RCC307: SynRCC307_1169Help
Entry
SynRCC307_1169    CDS       T00523                                 

Gene name
rbsK
Definition
(GenBank) Sugar kinase, ribokinase family
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
syr  Synechococcus sp. RCC307
Pathway
syr00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:syr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SynRCC307_1169 (rbsK)
Enzymes [BR:syr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SynRCC307_1169 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-ProteinID: CAK28072
CyanoBase: SynRCC307_1169
CYORF: SynRCC307_1169
UniProt: A5GT63
Position
complement(1033337..1034155)
Genome map
AA seq 272 aa AA seqDB search
MSELAVVGHTEWVEFLRVPHLPKPGQILHAEGLLAQPAGGGAVAAVQLARLVGSAHFITA
LGRDSLGEQALQQLQALGLRVSVVWRDQPTRRAITYIDAEGERSITVVGQRLSPQAGDAL
PWDELTRCDGVYVTATDAAGLRLARKAAVLTATPRTGLGILEASGVQLDALIGSGRDPSE
QVPDGSLSHPPTLRIATEGDQGGWSEPGGRFAAIERGKPQGDTYGAGDCFAAGVTAGLAM
GMGSQQAISLGCRCGSHCIDGVGAYAAMMVGL
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagctggcggtggtggggcacaccgagtgggtggaattcctgcgggtgccgcac
ctgccgaagcctgggcaaatcctccatgctgagggcctgttggctcagcccgctggtggc
ggagcggtggcggcagttcagctggcccgcttggtggggagcgcccacttcatcacggct
cttggccgtgattcgcttggtgaacaggccctccagcagctccaggcgctggggctcagg
gtttcggtggtgtggcgtgatcagcccacacggcgggccatcacctacatcgatgccgaa
ggtgagcgaagcatcaccgtggtggggcaacggttaagcccccaggcgggtgatgcgctg
ccatgggatgagttaacccgctgcgatggggtgtacgtcacagcaaccgatgcagcagga
ctgcggttagcgcgcaaggccgcggtgctgaccgccactccgcgaacaggtttagggatc
ttggaggcgtcgggcgttcagctcgatgccttgatcggcagcgggcgcgatccgagcgag
caggtgccagacggatccttaagccatccccccacactgcggattgccaccgaaggagac
cagggcggctggagtgaacctgggggacgctttgccgccatagagcgggggaagccccaa
ggcgacacctacggagccggggattgttttgccgctggtgtcaccgcgggtttggccatg
ggcatgggctcgcagcaggccatctccctcggatgccgctgcggttcccactgcatcgat
ggggttggcgcttacgcagcgatgatggtgggactctga

DBGET integrated database retrieval system