KEGG   Synechococcus sp. RCC307: SynRCC307_1322Help
Entry
SynRCC307_1322    CDS       T00523                                 

Gene name
ruvA
Definition
Holliday junction resolvasome DNA-binding subunit
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
syr  Synechococcus sp. RCC307
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:syr03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1171301..1171927
Genome map
AA seq 208 aa AA seqDB search
MIGWLHGTIGDRWQEGNRCWLLLICGPVGYELQVSESLWRGTALESPTTVHTHLQQREDG
QQLYGFETKADRNLFRLLISVNGVGPQVALGLISGLGAVSLLQAMAAEDVKVLCQAPGVG
KRTAERLSLEWRSRLQERWQQQGGSTPLRLVEPVAESRELRATLEALGYGPEEVSAAVAQ
AGSQGLDPEQPMEEWLRHCLAWLSRQAG
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgatcggttggttgcatggaacgatcggtgatcgctggcaagagggcaaccgctgctgg
cttctgttgatctgcgggccagttggttacgagctgcaggtgagcgagagcctctggcga
ggcaccgctttggagagcccaacgactgtccatacccatctgcagcaacgcgaggacggc
caacagctctatggctttgaaaccaaagccgatcgcaacctgttccgcttgttgatcagt
gtcaatggcgtgggtccgcaggtcgccctgggactgatctcaggtttgggcgcggtgagc
ttgctgcaagcaatggcagcagaagacgtcaaagtgctttgccaagcgcccggcgttggc
aaacgcaccgccgagcggctcagcctggaatggcgctcacggctgcaagagcgctggcaa
cagcaggggggatccacaccgctgcgcctggtggagccggtggcggaaagccgggaactg
cgcgccaccctggaagccctcggctatgggccagaagaagtgagcgcggcggtagcccaa
gcgggcagccaaggccttgatccggaacaacccatggaggagtggttacggcattgcttg
gcgtggctgagccgtcaagcgggctag

DBGET integrated database retrieval system