KEGG   Synechococcus sp. RCC307: SynRCC307_1345Help
Entry
SynRCC307_1345    CDS       T00523                                 

Gene name
acsA
Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
syr  Synechococcus sp. RCC307
Pathway
syr00010  Glycolysis / Gluconeogenesis
syr00620  Pyruvate metabolism
syr00640  Propanoate metabolism
syr00680  Methane metabolism
syr01100  Metabolic pathways
syr01110  Biosynthesis of secondary metabolites
syr01120  Microbial metabolism in diverse environments
syr01130  Biosynthesis of antibiotics
syr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:syr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SynRCC307_1345 (acsA)
   00620 Pyruvate metabolism
    SynRCC307_1345 (acsA)
   00640 Propanoate metabolism
    SynRCC307_1345 (acsA)
  Energy metabolism
   00680 Methane metabolism
    SynRCC307_1345 (acsA)
Enzymes [BR:syr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SynRCC307_1345 (acsA)
Lipid biosynthesis proteins [BR:syr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SynRCC307_1345 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CAK28248
CyanoBase: SynRCC307_1345
CYORF: SynRCC307_1345
UniProt: A5GTN9
Position
complement(1190159..1192198)
Genome map
AA seq 679 aa AA seqDB search
MSAVSRLGSGVGLIPLVCTAPLMADPQIESVLQEERVFAPPQSLSAEAAVGSLEAYRALV
AQADADPDAFWGEQAKEHLHWFQPFEQVLDWSNPPFARWFEGGTTNLSYNCLDRHLDGPR
AEKTALIWEGEPGDVRRFSYRELHAEVCRAANALKALGIGKGDLVALYMPMVPEAAIAML
ACARIGAPHSVVFGGFSADALRDRLIDGEAKAVITADGGFRKDKPVALKPAVDEALAGGA
VPSVQAVLVVQRTQGAVTMEPGRDHWWHDQVPLQAADCPAEPMASEDRLFVLYTSGSTGK
PKGVVHTTAGYNLWAHLTFRWIFDLKEDDVHWCTADVGWITGHSYIVYGPLSNGATTVMY
EGAPRPSKPGAFWELIEKHKITLFYTAPTAIRAFMKSGRSVPDGYDMSSLRILGTVGEPI
NPEAWIWYRDVIGANRCPIIDTWWQTETGGVMISPLPGATPTKPGSATLPLPGIAADVVD
ASGQSAGADEGGFLVVRRPWPGMMRTVHGDPDRFRRSYWEHLRAADGSAIYFAGDGARRD
GDGYFWVMGRVDDVINVSGHRLGTMEIESALVSHPAVAEAAVVGRPDELKGEGIVAFVSL
EGGRQGSPELMAELRKHVGAEIGPIARPDEIRFSDALPKTRSGKIMRRILRALAAGEEVS
GDTSTLEDRSVLERLRAEG
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagccgtgtcccgtctgggcagtggagtgggtttaattcctttggtatgcacggcc
ccgttgatggcggaccctcagatcgaatctgttctgcaagaagagcgtgtcttcgctcca
ccgcagtccctctctgctgaggcagccgttggctccttggaggcctatcgcgccttggtg
gcccaagccgacgctgatcccgatgctttctggggtgagcaggccaaggaacacctgcat
tggttccagccctttgagcaggtgctcgattggagcaatccccccttcgcccgttggttc
gaaggcggcaccaccaacctctcctacaactgcctggatcgccatctcgatggcccccgg
gctgaaaagacagctttgatctgggagggcgagcctggcgatgtgcgccgcttcagctat
cgggagctccacgctgaggtttgccgcgctgccaatgccctcaaagcgctggggattggc
aagggcgatttggtcgccctctacatgccgatggtgccggaggcagcaatagcaatgttg
gcctgcgcccgcattggtgctccccactcggtggtgtttggtggcttttccgccgatgcc
ctgcgcgatcggctgattgatggggaggccaaagcggtgattaccgccgatggtggcttc
cgcaaagacaagccggtggccttgaagccggctgtggatgaagccttggcgggtggtgcg
gtgccgtcggtgcaggcggtgttggtggttcagcgcacccaaggcgccgtgacgatggaa
ccgggcagagaccattggtggcacgaccaggtgccgctgcaagcggcggattgccctgct
gagccgatggccagcgaagaccgcttgtttgtcctctacacctccggttcaaccggcaag
cccaaaggggtggttcacaccacggctggctataacctctgggcccacctcaccttccgc
tggatctttgatctcaaggaagacgacgtgcactggtgcaccgccgatgtggggtggatc
accggccatagctacatcgtttacggcccgctttccaatggcgccaccacggtgatgtac
gagggtgcgccaagaccctccaagccaggtgcgttctgggagctgatcgagaaacacaag
atcacgctcttctacacagcacccacggcgatcagggccttcatgaagagtggccgttcg
gtgcccgatggctacgacatgagctccctgcgcatcctcggcacggtgggagagccgatc
aatcctgaggcttggatctggtatcgcgatgtcatcggcgccaaccgttgcccgatcatc
gacacctggtggcaaaccgaaaccggtggcgtgatgatcagccccctgcccggggcgacg
cccaccaagcctggatcggcaacccttcccctgccgggaattgctgccgatgtggtggat
gcctccggtcagtcggctggtgccgatgagggtggcttcttggtggtgcgccggccctgg
ccgggaatgatgcgcacggtgcatggagatcccgatcgcttccggcgcagctactgggaa
cacctgcgtgctgctgatggcagcgcgatctacttcgccggtgatggggcccgccgtgat
ggcgatggctacttctgggtgatgggtcgcgttgacgatgtgatcaacgtctctggccac
cgtttgggcacgatggaaattgaatcggcgttggtgagtcaccctgctgtggccgaagcc
gcggtggttggccgccccgatgagctcaaaggggagggcatcgtcgcatttgtcagcctt
gagggggggcgccaaggcagcccagagttgatggccgagttgcggaagcacgtgggggct
gagatcggtccgatcgctcgccccgatgagatccgcttcagcgatgccctgcccaagacc
cgtagcggcaagatcatgcgccggatcctcagggccctagccgctggtgaggaagtcagc
ggtgacaccagcaccctggaggaccgcagcgttctcgagcggcttcgggctgagggttga

DBGET integrated database retrieval system