KEGG   Synechococcus sp. RCC307: SynRCC307_1382Help
Entry
SynRCC307_1382    CDS       T00523                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
syr  Synechococcus sp. RCC307
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syr00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    SynRCC307_1382 (glpK)
Enzymes [BR:syr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     SynRCC307_1382 (glpK)
Exosome [BR:syr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SynRCC307_1382 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1231166..1232695)
Genome map
AA seq 509 aa AA seqDB search
MVMQGMAEPLLLALDQGTSSSRAVIFDGSGQALASAQVPLPIEYPADGWVEQDPLAIWSS
QLQAMQQLEDQLSPEQRAAVAACGITNQRETTVLWRSEQGQPCGPALVWQDRRTASICRQ
WRQQPEAESWQQRTGLVLDPYFSASKVQWLLQNNAEAAAAQADGTLRFGTVDSWLLWQLT
AGSVHATDLSNASRTLLLDLDRGCWLPEACERVGLTASALPELKPCRSHFGCIAEGRPFA
GVPITAMLGDQQAASFGQLCLEPGQAKCTYGTGAFLVINVGSTPVRAPGGLLSTVGWTEA
DGSTTYCIEGSLFNAGTVVQWLRDGLGLIPNSAAIEELAASVDSAGELMLVPAFTGWGTP
HWDPEARGLMIGLTRDTGPGQIARAALEGIALAVTTLMQLAEQALGQPLHELAVDGGAAA
SDLLLQAQANSSGVPVRRPDQLESTALGVALLAGLSAGCLSDLNAVRQARAAGSRRFDPT
IDAAERERWLQRWESAVHRCLEWHGDALR
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
gtggtgatgcaaggcatggccgaaccccttttgctggcccttgatcaaggcaccagcagc
tcccgcgccgtgatttttgatggcagcggacaagccttggcgtcggcgcaagtcccgttg
ccgattgagtacccagctgatggttgggtggaacaggacccgcttgcgatttggagcagc
cagctccaagccatgcagcagctggaggatcaattgagcccggagcagcgtgctgccgtg
gccgcctgtggcatcaccaatcagcgcgaaaccactgtgttgtggcgatctgagcaaggc
cagccctgcggcccggctttggtctggcaggaccggcggaccgcttctatttgccgccag
tggcgtcagcagcccgaagctgagagctggcagcagcgcacggggctggtgctcgatccc
tatttcagtgccagcaaggtgcagtggctgctgcagaacaacgccgaggccgctgcagcc
caggccgatggcaccctgcgctttggcactgtcgacagctggctgctgtggcagctgacc
gctggctcggtgcatgccactgacctcagcaatgccagccgcaccttgctgttggatctc
gatcgcggctgttggctgccggaggcctgtgagcgggtgggtttaacggcctcggccctg
ccggagctcaagccctgccgcagccatttcggctgcatcgctgaaggtcggccctttgcc
ggggtgccgatcaccgccatgctcggagatcaacaggccgccagttttggtcagctgtgc
ttggagcctggccaggccaaatgcacctatggaacgggcgctttcctggtgatcaatgtg
ggctcaacgcctgtgcgcgcacccgggggcttgctcagcaccgtgggatggaccgaggcc
gatggcagcaccacttattgcatcgaaggcagcctgtttaacgccggaaccgttgtgcaa
tggctgcgcgatggcttgggtctgattcccaactcagcggcgattgaagagttggccgct
tcggtcgatagcgctggtgaactgatgctggtgcccgccttcaccggttggggcactccc
cactgggatcccgaagcccgtggcttgatgattggcctgacccgagacaccgggcctggc
cagattgcccgcgcggccctcgagggcattgccttagccgtaacaacgctgatgcaactg
gctgagcaagccttgggacagccgctgcatgagctggcggtcgatggcggcgccgccgcc
tccgatctcctgttgcaggctcaagccaatagcagtggggtgcccgtacgccgccccgat
cagctggagagcacggccttgggtgttgccctgctggctggtctctcagctggatgtttg
agcgatctcaacgccgtgcgccaagcccgtgccgccggcagccggcgctttgatccgacg
attgatgcggccgagcgtgaacgctggctgcagcgctgggagagcgccgttcaccgttgc
ttggagtggcatggcgatgccctgcgctga

DBGET integrated database retrieval system