KEGG   Synechococcus sp. RCC307: SynRCC307_1491Help
Entry
SynRCC307_1491    CDS       T00523                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
syr  Synechococcus sp. RCC307
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:syr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SynRCC307_1491 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SynRCC307_1491 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SynRCC307_1491 (thrC)
Enzymes [BR:syr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SynRCC307_1491 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1326520..1327806)
Genome map
AA seq 428 aa AA seqDB search
MTATLTSQTFAGLRCKECGHAYAPEARHVCEDVCFGPLEVVYDYDAIRSRVSRASIEAGP
ASIWRYREFLPIEGDPIDVGTGFTPLLRANRLARRLGLKELYIKNDGVNMPTLSFKDRVV
SVALTRARELGFSTVSCASTGNLANSTAAIAAHAGMECCVFIPADLEAGKILGTLVYNPT
LMAVRGNYDQVNRLCSEVANTYGWGFVNINLRPYYSEGSKTLGYEVVEQLGWRLPDHIVA
PLASGSLFTKIRKGFDEFMKVGLVEEKHVRFSGAQAEGCSPIAQAFAEGRDFITPVKPNT
IAKSIAIGNPADGPYALDIASRTGGSIAAVNDEEIIEGIKLLAETEGVFTETAGGTTIAV
LKKLVEQGKIDPSETTVAYITGNGLKTTEAVASAVGEPLTIDPQLADFNAAWERAQSLQR
ATWDTVGV
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcaaccctgacatcgcagaccttcgcaggcctgcgctgcaaagaatgtggccat
gcctatgcgcccgaagcgcgtcacgtctgtgaagacgtctgctttggccccttagaagtt
gtttacgactacgacgccatccgttcccgcgtcagccgtgcctctattgaggccggtcct
gcttcgatttggcgttatcgcgagttcctgcccatcgagggtgatccgattgatgtcggc
actggcttcaccccgttgctgcgcgccaaccgtttggctcgccgccttggtctcaaggag
ctttacatcaaaaacgatggggtcaacatgcccaccctctcgttcaaagacagggtggtg
agcgtggccttgacccgggcccgggaattgggcttctccacggtgagctgtgccagcacc
ggcaacctcgcgaactccaccgccgccatcgctgcgcacgccggcatggagtgctgcgtc
ttcattccagctgatttggaagctggaaaaatcctgggcaccttggtctacaaccccacc
ttgatggcggttcgcggcaactacgaccaggtcaaccgtctctgctctgaggtggccaac
acctatggctggggcttcgtcaacatcaatctgcgtccctattactccgagggttccaag
accctgggctatgaggtggtcgagcaattgggctggcgcctgccggatcacatcgtcgcg
cccctcgcctccggctccctgttcaccaagatccgcaagggctttgatgaattcatgaag
gtgggcctggtggaggaaaagcacgtgcgcttcagcggtgcccaggccgagggctgctcc
ccgattgcgcaagcctttgccgaaggtcgcgacttcatcactccggtgaaacccaacacc
atcgccaagtccattgccatcggtaaccccgctgatggtccctatgccctggatatcgct
agccgcaccggcggctcgatcgcagcggtgaacgatgaggagatcatcgagggcatcaag
ctcttggccgaaaccgaaggtgtgttcaccgaaaccgccggtggcaccaccatcgccgtg
ctgaagaagctggtggagcaaggcaagatcgacccctccgagaccaccgttgcctacatc
accggtaatggcctcaagaccaccgaggcggtggcgtccgccgttggtgagccgctcacc
atcgatcctcaattggctgatttcaatgccgcctgggagcgcgcccagtcattgcagcgc
gccacctgggacaccgttggcgtttga

DBGET integrated database retrieval system