KEGG   Synechococcus sp. RCC307: SynRCC307_1491Help
Entry
SynRCC307_1491    CDS       T00523                                 

Gene name
thrC
Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
syr  Synechococcus sp. RCC307
Pathway
syr00260  Glycine, serine and threonine metabolism
syr00750  Vitamin B6 metabolism
syr01100  Metabolic pathways
syr01110  Biosynthesis of secondary metabolites
syr01120  Microbial metabolism in diverse environments
syr01230  Biosynthesis of amino acids
Module
syr_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:syr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SynRCC307_1491 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SynRCC307_1491 (thrC)
Enzymes [BR:syr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SynRCC307_1491 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DUF35_N
Motif
Other DBs
NCBI-ProteinID: CAK28394
CyanoBase: SynRCC307_1491
CYORF: SynRCC307_1491
UniProt: A5GU35
Position
complement(1326520..1327806)
Genome map
AA seq 428 aa AA seqDB search
MTATLTSQTFAGLRCKECGHAYAPEARHVCEDVCFGPLEVVYDYDAIRSRVSRASIEAGP
ASIWRYREFLPIEGDPIDVGTGFTPLLRANRLARRLGLKELYIKNDGVNMPTLSFKDRVV
SVALTRARELGFSTVSCASTGNLANSTAAIAAHAGMECCVFIPADLEAGKILGTLVYNPT
LMAVRGNYDQVNRLCSEVANTYGWGFVNINLRPYYSEGSKTLGYEVVEQLGWRLPDHIVA
PLASGSLFTKIRKGFDEFMKVGLVEEKHVRFSGAQAEGCSPIAQAFAEGRDFITPVKPNT
IAKSIAIGNPADGPYALDIASRTGGSIAAVNDEEIIEGIKLLAETEGVFTETAGGTTIAV
LKKLVEQGKIDPSETTVAYITGNGLKTTEAVASAVGEPLTIDPQLADFNAAWERAQSLQR
ATWDTVGV
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcaaccctgacatcgcagaccttcgcaggcctgcgctgcaaagaatgtggccat
gcctatgcgcccgaagcgcgtcacgtctgtgaagacgtctgctttggccccttagaagtt
gtttacgactacgacgccatccgttcccgcgtcagccgtgcctctattgaggccggtcct
gcttcgatttggcgttatcgcgagttcctgcccatcgagggtgatccgattgatgtcggc
actggcttcaccccgttgctgcgcgccaaccgtttggctcgccgccttggtctcaaggag
ctttacatcaaaaacgatggggtcaacatgcccaccctctcgttcaaagacagggtggtg
agcgtggccttgacccgggcccgggaattgggcttctccacggtgagctgtgccagcacc
ggcaacctcgcgaactccaccgccgccatcgctgcgcacgccggcatggagtgctgcgtc
ttcattccagctgatttggaagctggaaaaatcctgggcaccttggtctacaaccccacc
ttgatggcggttcgcggcaactacgaccaggtcaaccgtctctgctctgaggtggccaac
acctatggctggggcttcgtcaacatcaatctgcgtccctattactccgagggttccaag
accctgggctatgaggtggtcgagcaattgggctggcgcctgccggatcacatcgtcgcg
cccctcgcctccggctccctgttcaccaagatccgcaagggctttgatgaattcatgaag
gtgggcctggtggaggaaaagcacgtgcgcttcagcggtgcccaggccgagggctgctcc
ccgattgcgcaagcctttgccgaaggtcgcgacttcatcactccggtgaaacccaacacc
atcgccaagtccattgccatcggtaaccccgctgatggtccctatgccctggatatcgct
agccgcaccggcggctcgatcgcagcggtgaacgatgaggagatcatcgagggcatcaag
ctcttggccgaaaccgaaggtgtgttcaccgaaaccgccggtggcaccaccatcgccgtg
ctgaagaagctggtggagcaaggcaagatcgacccctccgagaccaccgttgcctacatc
accggtaatggcctcaagaccaccgaggcggtggcgtccgccgttggtgagccgctcacc
atcgatcctcaattggctgatttcaatgccgcctgggagcgcgcccagtcattgcagcgc
gccacctgggacaccgttggcgtttga

DBGET integrated database retrieval system