KEGG   Synechococcus sp. RCC307: SynRCC307_1557Help
Entry
SynRCC307_1557    CDS       T00523                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
syr  Synechococcus sp. RCC307
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:syr03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1375133..1376566
Genome map
AA seq 477 aa AA seqDB search
MSEASRCQRAAARLLSLAPAAVQAEAKGLQPLLERLLLCQLQGREPLQLDAAERAELTAA
SQSALQQLPVVLVEQGAQGAELWSRRQHQQQQSLLMELEQRLHQHRGLLLTGGAGTGKTT
RVRELLADERERHTLLLAPTGKAAARLREALSPLPASMQCSTLHRALEANPSGGFGRNQQ
RPINAEVVVVDEVSMVDTQLMQALLEALPSNTRLVLVGDSAQLPPIGGSSVLEPLEQQLK
QHRPQLLLQLERSHRFNDSTALGGFVQQLRGGSPTAELQQQLAAKAEHSNLHWWPLEQGW
PLALQQRIEQHRQRLEQQAHNTALSDAEALACLEDLLVLSPRRSGRQGVSQLNRRWLPLT
QREPWHWPAGTPLLVGRNDASLGLANGDRGLVRPGPQGQEAVIATAEGPRRLPLELLPCP
EPALALTVHKSQGSQAREVIVVLPAGSGLDRRLLYTALTRAQERLDLLSPPLDSLEA
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagccagtcgctgccagcgggctgctgcccgactcctgagcctggccccagcc
gcggtgcaggcggaagccaaaggcttacaaccactgctcgaacgcttgctgctctgccaa
ctccagggccgtgaacccttgcagctcgatgcagccgaacgcgctgaactcacggcggcc
agccaatccgccctgcagcagctacccgtggtgctggttgagcagggcgcgcaaggcgct
gaactctggagccggcggcaacaccagcagcagcagagcctgctgatggagttggagcaa
cggctgcatcaacacaggggactgctgctcaccggcggcgccggaacgggcaaaaccacc
cgcgtcagggaactgctcgctgatgagcgtgaacgccacaccctgctgctggcaccaacc
ggcaaggcagcggcacggctgcgggaagccctcagcccgctgccagcctcgatgcagtgc
tccaccttgcatcgcgccttggaagccaatcccagcggtggttttggccgcaaccagcag
cgccccatcaatgccgaggtggtggtggtcgatgaggtgtcgatggtggacacccagttg
atgcaagccctgctggaggcgctgccgagcaacaccaggcttgtgttggtgggtgattcc
gcccaattgccgcccattggcggcagcagcgtgctggaaccgctcgaacagcagctcaag
caacaccggccgcagctgctgttgcagctggagcgctcccatcgcttcaacgactccaca
gctctggggggctttgtgcaacagctgcgcggaggcagccccaccgctgaactacagcaa
caactggctgccaaagctgagcacagcaacctgcattggtggccgcttgagcagggatgg
cccctggccttgcaacagcgcatcgagcagcaccgccaacggctggagcaacaggcccac
aacacggctctcagtgatgccgaggccctggcctgcctcgaggacttgctggtgctctcg
ccacggcgcagtggccgtcagggggtgagccaactgaaccgccggtggctgcctctcacc
caacgggagccctggcattggcctgcgggcacccccctgctggtggggcgcaacgatgcc
tccttggggctcgccaatggtgaccgcggcctggtgcggcctggcccgcagggacaagag
gccgtgatcgccacggccgaaggccccaggcggctgcctttggaactgttgccttgcccc
gaaccagcccttgccctcacggtgcacaaaagccaaggcagccaggctcgcgaggtgatc
gtggtgctgccagcgggcagcggcttggatcgccgcttgctctacacggctctaacgcgg
gcccaagagcggctggacttgctgagtccgccgttagacagcctcgaggcgtaa

DBGET integrated database retrieval system