KEGG   Synechococcus sp. RCC307: SynRCC307_1600Help
Entry
SynRCC307_1600    CDS       T00523                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
syr  Synechococcus sp. RCC307
Pathway
syr00260  Glycine, serine and threonine metabolism
syr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
syr01100  Metabolic pathways
syr01110  Biosynthesis of secondary metabolites
syr01130  Biosynthesis of antibiotics
syr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:syr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SynRCC307_1600 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SynRCC307_1600 (trpA)
Enzymes [BR:syr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SynRCC307_1600 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth CinA NanE
Motif
Other DBs
NCBI-ProteinID: CAK28503
CyanoBase: SynRCC307_1600
CYORF: SynRCC307_1600
UniProt: A5GUE4
Position
complement(1410489..1411310)
Genome map
AA seq 273 aa AA seqDB search
MTVAPGSTAISSRFAGLKQQGRCALMPFLTAGDPDLATTSAALLALQANGADLVELGIPY
SDPLADGPVIQAAASRALEVGTTPASVLEMLAGLKGELTMPLVLFTYSNPLLNVGMERFC
ADAAAAGAAGLVVPDLPLEEAEKLSPIAAAQGLDLVLLVAPTTPAERMARIAAASRGFTY
MVSVTGVTGERAQMESRVAGLVGQLKAMGPTPVAVGFGISGPQQAIEVRSWGADGAIVGS
ALVKRMAQAKADGGDPVATAGAFCAELRAALDS
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtggcccctggctccactgccatctccagccgctttgctgggctcaagcagcag
ggccgttgcgcgctgatgcctttcctcaccgcgggtgatcctgatctggccaccacgagt
gcggccttattggccctgcaagccaatggggctgatctggtggagctggggattccctat
agcgatcccctggctgatggcccggtgatccaggccgctgccagccgtgcccttgaggtc
ggcaccactcctgcttcggtgctggagatgttggctgggctgaagggcgagctcaccatg
ccgttggtgctgttcacctacagcaacccactgctgaatgtgggcatggagcgcttctgc
gctgacgcggctgccgctggagcggcagggttggtggtgcctgatctgccgcttgaggaa
gccgaaaagctctcccccatcgccgcggcccaagggctggatctggtgctgctggtggcg
cccactaccccggctgagcgcatggcccgcattgcagccgccagtcgcggcttcacctac
atggtgagcgtgactggtgtcaccggtgagcgggcgcaaatggaatcgcgggtggctggt
ttggtggggcagctcaaggccatgggacccacgccagtggccgtgggctttggcatctcc
ggcccgcagcaagccattgaagtgcgcagctggggcgctgatggcgcgattgtgggcagt
gccttggtcaagcgcatggcccaggccaaagccgacggcggcgatccggtggccacagct
ggtgccttctgcgcagagctgcgtgctgccctcgatagctga

DBGET integrated database retrieval system