KEGG   Synechococcus sp. RCC307: SynRCC307_1962Help
Entry
SynRCC307_1962    CDS       T00523                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
syr  Synechococcus sp. RCC307
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:syr01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:syr00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1706458..1707768
Genome map
AA seq 436 aa AA seqDB search
MIVSTDAMMQLLNDPVAAVDRLRQIEARTHSSGVATAQATVDSVLAAVKERGDAALKEYT
ERFDGVVLDCLRVDPAATKAAWQSAPLALRDALQLAHRRISAFHREQLPQDIELKGPHGE
RLGRRWRPVNSAGLYVPGGRAAYPSTVLMNAIPAQVAGVKQVVMVTPPGPDGQVNPAVLA
AAHVAGVDQIYSVGGAQAVAALAFGTESIPAVDVITGPGNLFVTLAKKSVYGRVGIDSLA
GPSEVLVIADDSASAELVAADLLAQAEHDPLAAAILLTTSPRLVQEVPEAIAAQLEDHPR
REVTEASIRDWGLIVLCESLEQAAQLSDRFAPEHLELLVQEPAALAERIQQAGAIFMGQH
TPEAAGDYLAGPNHTLPTSGTARFAGALSVETFMRHTSLINFNRQALEATGAAIMELAAH
EGLHSHRESVRRRLQS
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
gtgattgtctcgacagacgcgatgatgcagctgctcaacgaccctgtcgcggccgttgat
cgtctgcggcaaatcgaagcgagaacccactccagtggcgtcgctacagcgcaagccacc
gtggattccgttcttgcggctgtcaaagagcgcggcgatgcagccctcaaggagtacacc
gagcgttttgacggggttgtgctcgactgcctgcgggtggatccagccgcgactaaggcg
gcctggcagagcgctcccctggctttgcgcgatgccctgcaactggcccatcggcgcatc
agcgcttttcaccgcgaacaattaccgcaggacatcgagctcaaaggtccccatggggaa
cgccttggcaggcgttggcgcccggtcaactccgctgggctctatgtgcctggtggccgc
gcggcttaccccagcacggtgttgatgaatgccatccccgcccaagtcgcgggggtgaag
caagtggtgatggtcaccccgccagggccagacgggcaagtcaaccccgccgtgttggcg
gccgcccacgtggctggcgtcgatcagatctacagcgtcggcggcgctcaagccgtggcg
gcgctggccttcggcaccgagtcgatccccgcggtggacgtgatcaccggacctggaaat
ttgtttgtgaccctggccaaaaaaagcgtgtatggccgggttggcattgattcgctggct
gggcccagcgaagtgttggtgatcgccgatgacagcgcctcagccgagctggtggcggcg
gatttgctggcccaagcagagcacgaccccctggctgcagcgattctgctgaccaccagc
ccgcgcctcgtgcaagaggtgcccgaggcgattgcagcgcaactggaggatcaccccagg
cgcgaggtaacggaagcctcgatccgcgattggggcttaatagtgctctgcgaatcactc
gagcaagccgcgcagctctccgatcgctttgctcctgaacatctggagttgttggtgcag
gaaccagccgcgctggctgaacgcattcagcaggccggcgcgatcttcatgggacagcac
accccagaagcagctggcgactaccttgctgggcccaatcacaccctgccgacctccggg
acagcccgctttgctggcgccttgagcgtcgaaacgttcatgcgccacaccagcctgatc
aacttcaaccggcaagcgcttgaagccacgggcgcagcgatcatggagttagcagcccat
gagggattgcatagtcaccgcgagtcggtgcgccgcaggctgcagagctga

DBGET integrated database retrieval system