KEGG   Synechococcus sp. RCC307: SynRCC307_2002Help
Entry
SynRCC307_2002    CDS       T00523                                 

Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
syr  Synechococcus sp. RCC307
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:syr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SynRCC307_2002
Enzymes [BR:syr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     SynRCC307_2002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1734351..1736087
Genome map
AA seq 578 aa AA seqDB search
MQGSALHSGQLDALLGELYREESSEFIQELSSQLLQSLQTSTKQITEQQPRWDASTAVLI
TYANTLQRDGERGLTTLKGVLNTHFSALDGVVHVLPFLKASSDGGFAVASHSELEPGFGE
WTDLAALAEGRTVMADLVLNHVSASHPWVLQFLQRSEPGRSCILAPDPEAGWANVIRPRS
TSLFTTLATDDGPRPVWSTFGPDQLDLDWSEPQVLLGFSELLGRLSRHGVSWLRLDAVGF
VWKEEGTTCLHRPQAYTVVRILRQLLETVSSRGVVVTETNVPEQENLSYLRSGNDAHLAY
NFPLPPLLVEALISRRADLLNQWLARWPELPAGTSLLNFSACHDGIGLRPLEGLMPPERV
HELLVACERRGGLVSHRRLASGKESPYEINISWWSAMADGGVDPSHLQLQRFLLSQLLVM
ALPGVPAFYLPALVAAANDMKQFRSTGHRRDLNRPKFQAERLERQLADPDQPASKILKRL
QAAMELRSQRPAMDPEAPMELLSSDRSDVVILKRGTQSQALWAVHNFSNRRLSFPLAKRL
QLPTDTAKLSWSDALSGSTIGGPYLELEPFAVHWLELG
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgcaggggagtgccctacacagcggccaattggacgcactccttggtgagctctatcgg
gaggagtcttccgagttcatccaagaactgtcgtcgcaattgctgcaatctctgcaaacc
agcacaaagcagataaccgagcaacaaccccgttgggatgccagcaccgccgttctgatc
acctacgccaacaccttgcaacgggatggcgaaaggggcctaacaacgctcaaaggcgtt
ctgaacacccacttcagcgctctcgatggtgtggtgcatgtgttgcccttcctcaaggcc
agtagcgatggcggctttgcggtagccagccatagcgaactggagccaggctttggcgaa
tggaccgatctcgctgcactcgccgaagggcgaacggtgatggccgatctggtcttgaac
catgtctctgcctcccatccctgggtgctgcaatttctgcagcgcagcgagcctgggcgg
agctgcatcctggctcccgatccagaggcaggctgggccaatgtgatccgcccacgcagc
accagcctgttcaccaccttggccaccgacgatgggccgaggcctgtgtggagcaccttt
ggccctgatcaactcgatctcgattggagcgagccccaggtgttgctgggcttcagcgaa
ctgctgggccggctgagccgccatggggtgagctggctgcgcctcgatgccgtgggattt
gtgtggaaagaagagggcaccacatgcctgcatcgcccgcaggcctacacagtggttcgc
atcctgcggcaactgctggagacggtcagtagccgcggcgttgtggtgaccgaaaccaac
gttcccgagcaggagaacctctcttacctgcgcagcggcaacgatgcccatctggcttac
aacttcccgctgcccccgctgctggtggaggccctgatcagccgccgcgctgacctgctg
aatcaatggctcgcgcgctggcctgagctcccagctggcaccagcctgctgaatttcagc
gcctgccatgacggcattggcttgcgtccactcgaaggcctgatgcctcctgaacgagtg
catgagctgctggtggcctgtgagcgccgtggtggcctggtcagccaccggcgcctcgca
agcggcaaggaatcgccctacgagatcaacatcagctggtggagcgccatggctgatggc
ggcgtggatccctcccatctccagctgcaacgcttcctactgagccagctgctggtgatg
gctctgccaggggtgccagcgttttatttgccagcgttggtagcggctgccaacgacatg
aagcagttccgcagcacggggcatcgccgcgatctcaaccgccccaaatttcaagcggaa
cgcttggaacgccaactcgctgatcccgaccaaccagccagcaaaattttgaagcggctg
caagcagcgatggagcttcgcagccagcgtccggcgatggatcctgaagcgccgatggag
ttgctgagcagcgatcgcagtgatgtggtgatcttgaagcgtggaacacaaagccaggcg
ctctgggccgtgcacaatttcagcaaccgcaggttgagcttccccttggccaagaggctg
caactcccaacagatacggccaagctcagctggtctgacgcgctcagtggctccacgatc
ggtggcccttatctcgagttggagccgtttgccgtgcattggctggagctgggttga

DBGET integrated database retrieval system