KEGG   Synechococcus sp. RCC307: SynRCC307_2271Help
Entry
SynRCC307_2271    CDS       T00523                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
syr  Synechococcus sp. RCC307
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:syr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SynRCC307_2271 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SynRCC307_2271 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SynRCC307_2271 (trpB)
Enzymes [BR:syr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SynRCC307_2271 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1973782..1975050
Genome map
AA seq 422 aa AA seqDB search
MIAPVTSTLPNSAALDAASRPNGLGRFGRFGGQYVPETLMPALAELEAAAAEAWQDKAFT
DRLNALLRDYVGRPSPLYEAERLSEHYRRAEGGPRIWLKREDLNHTGAHKINNALGQALL
ALRMGKKRIIAETGAGQHGVATATVCARFGLECVIYMGAEDMRRQALNVFRMRLLGATVQ
PVTAGTATLKDATSEAIRDWVTNVESTHYILGSVAGPHPYPMLVRDFHACIGRETRQQCH
DAFGRLPDVLLACVGGGSNAMGLFHPFVADTSVRLIGVEAAGEGVASGRHAATITEGRTG
VLHGAMSLLLQDGDGQVMEAHSISAGLDYPGVGPEHSYLREIGRAEYAAVTDTQALDALQ
RLSQLEGIIPALETAHAFAWLESLCPTLAPGTEVVINLSGRGDKDVNTVAERLGDQLKPA
DG
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
ttgattgcgccggtgaccagcacgctgcccaactccgcggccctggatgccgcctctcgc
cctaacggtttgggccgcttcggccgttttggcggtcaatacgttcctgaaacgctgatg
ccagcgctggctgagctggaagccgccgccgctgaagcctggcaagacaaggccttcacc
gatcgcttaaacgcgctgctgcgcgattacgtgggccggcccagccccctctatgaggcc
gagcgcctcagcgagcactaccgccgcgctgaaggcggaccccgcatttggctcaagcgc
gaggacctcaaccacaccggcgcccacaagatcaacaacgcccttggccaagcgctgctg
gcgctacgcatgggcaaaaagcggatcattgctgaaaccggtgctggccagcacggcgtg
gccaccgcgaccgtctgcgcccgcttcggcctggagtgtgtcatctacatgggcgcggaa
gacatgcgtcgtcaggccctcaacgtcttccgcatgcgtctgttgggcgccaccgttcaa
ccggtgacagcgggcaccgccaccttgaaagacgccaccagcgaagccatccgcgattgg
gtgaccaacgttgagagcacccactacatccttggctcggtggctggcccgcatccctac
ccgatgctggtgcgcgacttccacgcctgcattggccgggaaacccgccagcagtgccac
gacgcctttggccggcttcctgatgtgttgttggcctgcgtgggtggcggttccaatgcc
atggggctcttccaccccttcgtagccgacaccagcgttcgcctcatcggcgttgaagcc
gccggtgaaggggtcgccagtggtcgccatgccgccacgatcaccgaagggcgcaccggc
gttctgcatggggccatgagcctgctgctgcaggacggcgatggccaggtgatggaggcc
cactccatcagcgctggccttgattaccccggcgttgggcctgagcacagctacctgcga
gagatcgggcgcgccgagtacgccgcggtaaccgacacgcaagccctcgatgccctgcag
cgcctcagccaactggaagggatcatcccggccctggaaactgcccatgcctttgcttgg
ctcgaaagcctctgcccaactctggctccaggcactgaggtggtgatcaacctctccggc
cgcggggacaaagacgtgaacaccgtggccgagcgcctcggcgatcaactcaagccagca
gacggctga

DBGET integrated database retrieval system