KEGG   Synechococcus sp. RCC307: SynRCC307_2393Help
Entry
SynRCC307_2393    CDS       T00523                                 

Definition
Fatty-acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
syr  Synechococcus sp. RCC307
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:syr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    SynRCC307_2393
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    SynRCC307_2393
Enzymes [BR:syr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     SynRCC307_2393
Lipid biosynthesis proteins [BR:syr01004]
 Desaturase
  First
   SynRCC307_2393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2089667..2090581
Genome map
AA seq 304 aa AA seqDB search
MVVAPTTAPTAAPVADDLHERLYGRRPPLPASQRKLKVGTTLFMLAMHVGAVFALLPRFW
SWQGLVAFGVLYWMTVLGVTLGLHRLMAHRSFEAPKWLERVLVVMGTLGCQGGPVEWVGL
HRHHHKFSDQPNDHHDAGRGLWWSHSEWMLHSIPALKHLDRFAGDMRRDPFYNWLDRFFL
LLQLPLGAALYWIGENTGVHGGGLGLVLWAIPLRLTVVYHVTWLVNSATHVWGYRNFDCP
DRSTNCWWVAILSFGEGWHNNHHAFPHSARHGLRWFEFDITWQHIRALKSLGLAKRIRLA
HYRP
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
ttggtcgtagcccctacaaccgcgccgacagccgcacccgttgcagatgatctgcacgag
cggctttacggacgccggcctccactgccggccagtcagcgcaagctgaaagtgggcacg
actctgttcatgctggcgatgcatgtgggcgccgtgtttgcgctgctgccgcgcttctgg
agctggcagggcctggtggcctttggcgtcctctactggatgaccgtgctgggggtgacc
ctgggcctgcaccggctgatggcccaccgcagctttgaagcccccaaatggctcgagcgg
gtgttggtggtgatgggcaccctcggctgccaaggcggcccggtggagtgggttggcttg
caccgccaccatcacaagttttctgatcaaccgaacgatcaccacgacgccggccggggc
ctgtggtggtcgcacagcgaatggatgctgcactccattccggccctgaagcacctggat
cgtttcgccggcgatatgcgccgcgatcccttctacaactggctcgaccgctttttcctg
ctgctgcagctgcccctaggcgcggctctctactggatcggcgagaacaccggcgtgcat
ggcggaggcctgggcctggtgctgtgggcgatccccctgcgcctcaccgttgtgtatcac
gtgacctggctggtgaactccgccacccacgtctggggttatcgcaacttcgattgccct
gaccgctccaccaactgctggtgggtggcgatcctcagctttggcgagggctggcacaac
aaccaccacgcctttccccactcagcccgccacggcctgcgctggtttgaattcgacatc
acctggcagcacatccgggccctcaagagcctgggcttggccaagcgcattcgcctggcc
cactaccggccctga

DBGET integrated database retrieval system