KEGG   Synechococcus sp. RCC307: SynRCC307_2535Help
Entry
SynRCC307_2535    CDS       T00523                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
syr  Synechococcus sp. RCC307
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:syr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SynRCC307_2535 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SynRCC307_2535 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SynRCC307_2535 (thrC)
Enzymes [BR:syr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SynRCC307_2535 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2223624..2224739
Genome map
AA seq 371 aa AA seqDB search
MAAAVPLLRSVRGLFKRPTTQNWQGLIPAYRRWLPVSDATPVISLCEGATPLVPAPAISE
RLGRGIRVFLKVDGHNPTGSFKDRGMTMAVSKAKEAGAEAVICASTGNTSAAAAAYARRG
GMRAFVLIPDGYVAQGKLAQALLYGAEVLAVRGNFDRALSIVREMADQYPVTLVNSLNPF
RLEGQKTAAFEVVDELGDAPDWLCIPMGNAGNISAYWMGFKEYRNAGMSRKLPRMMGFQA
AGSAPLVNDTTVEQPDTIATAIRIGNPANREKALKVRQESNGGFAAVTDAAILDAYRLLG
REEGVFCEPASAASVAGLLQRADEVPSGATVVCVLTGNGLKDPTSAIDHSEATFYGDLTP
DVATVAKTMGF
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
ttggccgcagctgtgcccttgctccgttccgttcgtggcctgtttaagcggcccaccaca
cagaactggcagggcctgattcccgcctaccgccgatggcttccagtcagtgatgccacc
ccggtgatcagcctgtgtgaaggcgccaccccactggttccagctccagccatctccgaa
cggctcggccgcggcatccgcgtgttcctcaaggtggatggtcacaaccccaccggcagc
ttcaaagaccgcggcatgaccatggcggtcagcaaagccaaagaagctggggctgaagcg
gtgatctgcgccagcactggcaacacctcagctgcagctgccgcctatgcccgtcgcggc
ggaatgcgggcctttgtgctgatccccgatggctatgtggcccaagggaaactggcgcag
gccctgctctacggcgcagaagtgctggctgtgcgcggcaactttgaccgggccttgagc
atcgtgcgcgagatggccgatcaatacccggtcaccctggtcaattccctcaacccattc
cgcctagaaggccagaaaacggcggcctttgaagtggtggatgaattgggtgatgccccc
gactggctctgcatccccatgggcaatgcgggcaatatcagcgcctactggatgggcttc
aaggaataccggaacgccggcatgagccgcaaattgccgcgaatgatgggcttccaagcg
gccggctctgcccctctggtgaacgacaccacggtggagcaacccgacacgattgccacc
gccatccgcatcggcaatcccgccaaccgcgaaaaagccctgaaggtgcgccaagagagc
aatggcggctttgctgccgtcaccgacgccgccatcctcgacgcctaccgcctgctgggc
cgggaagaaggagtcttctgtgagcccgcatctgccgcctcggtggcaggtctgctgcaa
cgggccgatgaagtacccagcggcgccacggtcgtgtgcgtgctcaccggcaatggcctc
aaggaccccaccagcgccatcgaccacagcgaggccaccttctacggcgatctcacgccc
gatgtggccaccgtggccaagacgatggggttctaa

DBGET integrated database retrieval system