KEGG   Synechococcus sp. RCC307: SynRCC307_2535Help
Entry
SynRCC307_2535    CDS       T00523                                 

Gene name
thrC
Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
syr  Synechococcus sp. RCC307
Pathway
syr00260  Glycine, serine and threonine metabolism
syr00750  Vitamin B6 metabolism
syr01100  Metabolic pathways
syr01110  Biosynthesis of secondary metabolites
syr01120  Microbial metabolism in diverse environments
syr01230  Biosynthesis of amino acids
Module
syr_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:syr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SynRCC307_2535 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SynRCC307_2535 (thrC)
Enzymes [BR:syr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SynRCC307_2535 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Peripla_BP_6 PK_C TPR_4 TPR_16
Motif
Other DBs
NCBI-ProteinID: CAK29438
CyanoBase: SynRCC307_2535
CYORF: SynRCC307_2535
UniProt: A5GX29
Position
2223624..2224739
Genome map
AA seq 371 aa AA seqDB search
MAAAVPLLRSVRGLFKRPTTQNWQGLIPAYRRWLPVSDATPVISLCEGATPLVPAPAISE
RLGRGIRVFLKVDGHNPTGSFKDRGMTMAVSKAKEAGAEAVICASTGNTSAAAAAYARRG
GMRAFVLIPDGYVAQGKLAQALLYGAEVLAVRGNFDRALSIVREMADQYPVTLVNSLNPF
RLEGQKTAAFEVVDELGDAPDWLCIPMGNAGNISAYWMGFKEYRNAGMSRKLPRMMGFQA
AGSAPLVNDTTVEQPDTIATAIRIGNPANREKALKVRQESNGGFAAVTDAAILDAYRLLG
REEGVFCEPASAASVAGLLQRADEVPSGATVVCVLTGNGLKDPTSAIDHSEATFYGDLTP
DVATVAKTMGF
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
ttggccgcagctgtgcccttgctccgttccgttcgtggcctgtttaagcggcccaccaca
cagaactggcagggcctgattcccgcctaccgccgatggcttccagtcagtgatgccacc
ccggtgatcagcctgtgtgaaggcgccaccccactggttccagctccagccatctccgaa
cggctcggccgcggcatccgcgtgttcctcaaggtggatggtcacaaccccaccggcagc
ttcaaagaccgcggcatgaccatggcggtcagcaaagccaaagaagctggggctgaagcg
gtgatctgcgccagcactggcaacacctcagctgcagctgccgcctatgcccgtcgcggc
ggaatgcgggcctttgtgctgatccccgatggctatgtggcccaagggaaactggcgcag
gccctgctctacggcgcagaagtgctggctgtgcgcggcaactttgaccgggccttgagc
atcgtgcgcgagatggccgatcaatacccggtcaccctggtcaattccctcaacccattc
cgcctagaaggccagaaaacggcggcctttgaagtggtggatgaattgggtgatgccccc
gactggctctgcatccccatgggcaatgcgggcaatatcagcgcctactggatgggcttc
aaggaataccggaacgccggcatgagccgcaaattgccgcgaatgatgggcttccaagcg
gccggctctgcccctctggtgaacgacaccacggtggagcaacccgacacgattgccacc
gccatccgcatcggcaatcccgccaaccgcgaaaaagccctgaaggtgcgccaagagagc
aatggcggctttgctgccgtcaccgacgccgccatcctcgacgcctaccgcctgctgggc
cgggaagaaggagtcttctgtgagcccgcatctgccgcctcggtggcaggtctgctgcaa
cgggccgatgaagtacccagcggcgccacggtcgtgtgcgtgctcaccggcaatggcctc
aaggaccccaccagcgccatcgaccacagcgaggccaccttctacggcgatctcacgccc
gatgtggccaccgtggccaagacgatggggttctaa

DBGET integrated database retrieval system