KEGG   Synechocystis sp. PCC 6803 PCC-N: SYNPCCN_0211Help
Entry
SYNPCCN_0211      CDS       T01778                                 

Gene name
chlD
Definition
Mg chelatase subunit
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
sys  Synechocystis sp. PCC 6803 PCC-N
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sys00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SYNPCCN_0211 (chlD)
Enzymes [BR:sys01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     SYNPCCN_0211 (chlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
231996..234026
Genome map
AA seq 676 aa AA seqDB search
MTTLTPFIPLNFPITAIVGQEAIKLALLLGAIDPGLGGIVIAGRRGTAKSVMARAIHTLL
PPIEIIKGNRYQCDPKNPGSWDDDTLEKFADVPLDQLETQVIPAPFIQIPLGVTEDRLLG
SVDVEKSVKQGEAVFQPGLLAQAHRGVLYIDELNLLDDQIANQLLTVLTEGKNQIEREGM
SFQHPCQPLLIATYNPEEGPLRRHLLDRIAIALSADGILGLDQRVAAVDQVLAYADSPIS
FIDQYDAELDDLKTTIILAREWLKEVSLTPEQVSYLVEEAIRGGLQGHRGELFAMRVAKA
IAALDGRSDVQADDLRQAVELVIVPRSVLMDNPPPPEQAPPPPPPPQNQDEGKDEQEDQQ
DDKEDDKDNEPEAEQDPPSIPEEFIFDPEGVSLDPSVLYFAQMAQKQGKSGSRSVIFSDD
RGRYLKPILPKGKVRRIAVDATLRAASPYQKSRRLRHPDRQVIVEQGDIRGKKLVRKAGA
LIVFLVDASGSMALNRMQAAKGAVMQLLTEAYENRDQVSLIPFQGENAEVLLPPTRSIAM
AKKRLETLPCGGGSPLSHGLMQAVNVGMNAKRSGDIGQVVIVAITDGRGNIPLARSLGDE
IPEGEKPDIKAELLEIAAKIRGLGMQLLVINTEKKFVSTGFGKELAQKAGGKYYQLPKAT
DQGIASMARQAIADMQ
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccctgaccccctttattcccctcaatttccccatcacggcgatcgtcggccaa
gaggcaatcaagctggctttactcctaggggcgatcgatcctggcttggggggcattgtt
attgccggacggcggggcacagccaaatcggtcatggctagggcaattcacactttgctc
cctcccattgaaatcattaagggcaaccgttaccaatgcgatccaaaaaatcccggcagt
tgggatgatgacaccctagaaaaatttgccgatgttcccctggatcaattggaaacccag
gtaattcccgctccctttattcaaattcccctgggggtcacggaggatcgcctgttggga
tcggtggatgtggaaaaatccgttaagcaaggggaagcggtgtttcagccgggattactg
gcccaggcccatcggggggtgctgtacattgacgagttgaatttactggatgaccagatt
gccaatcagttgctaacggtgttaacggaaggcaaaaaccagattgagcgggaaggcatg
agttttcagcatccctgccagcctttattaattgccacctataaccccgaagaagggccg
ttgcgtcgccatttattggaccgcattgcgatcgccttgagtgcggacggtattttgggg
ctggatcaacgggtagcggcggtggatcaggtgctagcctatgccgattctcccattagt
tttattgaccagtacgacgccgaattggacgacctaaaaaccaccatcattctggctcgg
gaatggctcaaggaagtgagtttaaccccggaacaggtgagttatctggtggaagaagca
atccggggcggcctccagggccatcggggagaattgtttgccatgcgggtagcgaaggcg
atcgccgctttggatggccgtagtgatgtgcaggctgatgatctgcggcaagcagtggaa
ttggtgattgtgccccgtagcgtgttgatggacaatcccccgcctccggaacaggctccc
cccccgccgccccctccccaaaatcaggatgaagggaaagacgagcaagaggatcaacag
gatgacaaggaagacgacaaagataatgaaccggaagcggaacaggatccccccagcatt
ccggaagaattcatttttgatcctgaaggagtaagccttgatccctcggtgctgtatttt
gcccagatggcccagaaacaaggtaaatccggcagtcgttccgtaattttttccgatgac
cggggccgttacctcaaaccgattttgcccaaaggaaaagtccgccgcattgctgtggat
gccacgttgcgggccgcttccccctaccaaaaatcccgtcgtttacgccatcccgatcgc
caggtaattgtggagcagggagatattcggggtaaaaagttagtgcggaaagccggggca
ttaattgtgtttttggtggatgcgtcgggttccatggcgttgaatcgtatgcaggccgcc
aaaggggcggtgatgcaattgctcacagaagcctacgaaaatcgagatcaggtttccctt
attcccttccagggagaaaatgccgaggtactattgccccccacccgttccattgccatg
gccaaaaaacggctggaaactttgccctgtggcggtggttctcccctttcccacggcttg
atgcaagcggtcaatgtgggtatgaatgctaaacgatccggggatattgggcaggtagta
attgtggccattaccgatggtcggggtaatattcccttggcccgttccctgggcgatgaa
attcccgaaggagaaaagcctgatatcaaagcggaattgttagaaattgccgccaagatt
cgcggtttagggatgcaattgttggtgatcaacaccgagaaaaaatttgtttccactggc
ttcggtaaagaattggcccaaaaagccgggggcaaatattatcaactccccaaagccact
gaccaaggtattgcctccatggcccgccaggcgatcgccgacatgcaatag

DBGET integrated database retrieval system