KEGG   Synechocystis sp. PCC 6803 PCC-N: SYNPCCN_0296Help
Entry
SYNPCCN_0296      CDS       T01778                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sys  Synechocystis sp. PCC 6803 PCC-N
Pathway
sys00260  Glycine, serine and threonine metabolism
sys00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sys01100  Metabolic pathways
sys01110  Biosynthesis of secondary metabolites
sys01130  Biosynthesis of antibiotics
sys01230  Biosynthesis of amino acids
Module
sys_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sys00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SYNPCCN_0296 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SYNPCCN_0296 (trpA)
Enzymes [BR:sys01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SYNPCCN_0296 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth ThiG NanE TMP-TENI FMN_dh IGPS
Motif
Other DBs
NCBI-ProteinID: BAL31213
Position
326138..326932
Genome map
AA seq 264 aa AA seqDB search
MNAVAACFNALRQRGECALIPFLTAGDPDLATTAEALRILDRAGADLIELGVPYSDPLAD
GPVIQAAATRALQKGVKLDDVLAIVREVHQDIAAPIILFTYYNPIFYQGVEVFLDKIKAA
GVKGLVVPDLPLEESDRLLEATAERGLELILLVAPTSSPERQTAIAKKSQGFVYLVSVTG
VTGVRTEVGSRVEALLAGMRQVTDKPIGVGFGISQPEQAEQVKAWGADAVIVGSAMVKRL
AEGTPTEGLQALETFCRELKTAIS
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctgttgccgcttgttttaatgcccttcgtcaacggggggaatgtgctttgatt
cctttcctcacagcgggggacccggatttagccaccacagccgaagcgttgcgaattcta
gaccgggcaggggcggatttaattgagttgggagtgccctattccgatcctttggccgat
ggcccggtgattcaagcggcggccactagggctttacaaaaaggggtcaagttggatgat
gtgctcgccattgtccgagaagttcaccaagatattgccgccccgataattttatttacc
tattacaatcctattttttatcagggtgtggaggttttcctcgacaaaatcaaggccgct
ggagtgaagggtttggtggtgccggatttacccctggaggaatctgatcgcctgttggaa
gcgacagcggaaagggggttggagttaattttgttggtggcccccaccagttccccagaa
agacaaacggcgatcgccaaaaagtcccagggctttgtttacttggtcagcgtgacaggg
gtgacgggggtgagaacggaagtgggatcgagggtggaagctttgttagcagggatgcgc
caggtcaccgataaaccgattggagttggttttggtatttcccaaccggaacaggctgag
caggtgaaagcttggggcgcagatgcagtaattgtaggaagcgccatggttaagcgttta
gcggaaggaaccccgacggaaggattgcaagctttggaaactttttgccgggaactgaaa
acggccatcagttaa

DBGET integrated database retrieval system