KEGG   Synechocystis sp. PCC 6803 PCC-N: SYNPCCN_0464Help
Entry
SYNPCCN_0464      CDS       T01778                                 

Gene name
chlH
Definition
Mg-chelatase subunit
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
sys  Synechocystis sp. PCC 6803 PCC-N
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:sys00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
508605..512600
Genome map
AA seq 1331 aa AA seqDB search
MFTNVKSTIRRVDPEALNGRQLLKVVYVVLESQYQSALSAAVRNINRTNSSLAIQLTGYL
IEELRDPENYANFKHDVSEANLFIASLIFIEDLADKVVEAVTPYRDNLDAAIVFPSMPQV
MRLNKMGSFSMAQLGQSKSAIAQFMKKRKENSSGAGFQDAMLKLLRTLPTVLKYLPVEKA
QDARNFMLSFQYWLGGSQENLENFLLMLTDKYVYPDLGLDKLVNYQEPVVYPDMGIWHPL
SMQMFENVKDYLEWYNQRPDISEDLKDPLAPCIGLIMQRTHLVTGDDAHYVGMVQELEAM
GARVICVFSGGLDFSKPVNEYFWDKSVNGVEPLPIVDAVVSLTGFALVGGPARQDHPRAI
ESLKKLNRPYMCALPLVFQTTEEWEASDLGLHPIQVALQIAIPELDGAIEPIILSGRDGS
TGRAIALQDRLEAIAQRAMKWANLRKKPKLDKKVAITVFSFPPDKGNVGTAAYLDVFGSI
YEVMKGLQGNGYDVQDLPGSAKELMEAVIHDAQAQYNSPELNIAHRMSVEQYERLTPYSV
RLEENWGKPPGHLNSDGQNLLIYGKEFGNVFIGVQPTFGYEGDPMRLLFSRSASPHHGFA
AYYTYLNHIWKADAVLHFGTHGSLEFMPGKQMGMSGECYPDNLIGTIPNLYYYAANNPSE
ATIAKRRGYASTISYLTPPAENAGLYKGLQELNELIGSYQTLKDSGRGIQIVNTIMDQAR
ICNLDQDVNLPDINAEEMDQGQRDTIVGSVYRKLMEIESRLLPCGLHVIGQPPSAEEAIA
TLVNIASLDREDEGIWALPTLIAESIGRNMEEIYRNSDKGILADVELLQDITLATRAAVA
ALVQEQINADGRVSFVSKLNFFKIGKKAPWVKSLCDSGYPNVNEEKLKPLFEYLEFCLEQ
VCADNEFGGLLQALEGEYVLPGPGGDPIRNPNVLPTGKNIHALDPQSIPTLAAVQSAKVV
VDRLLERQRAENGGNYPETIASVLWGTDNIKTYGESLAQIMWMVGAKPVPDALGRVNKIE
LVPLEELGRPRIDVVVNCSGVFRDLFINQMNLLDQAVKLAAEADEPLEMNFVRKHALEQA
EEMGIGVREAATRIFSNASGSYSSNVNLAVENSSWEDESELQEMYLKRKSFAFNSDNPGM
MDQNRDMFERALKTADATFQNLDSSEISLTDVSHYFDSDPTKLISTLRDDGKAPAAYIAD
TTTANAQVRTLSETVRLDARTKLLNPKWYEGMLSHGYEGVRELSKRLVNTMGWSATAGAV
DNWVYEDANSTFIKDEEMCKRLMDLNPNSFRRMVSTLLEVNGRGYWETSDENLERLQELY
QEVEDRIEGVE
NT seq 3996 nt NT seq  +upstreamnt  +downstreamnt
atgtttactaacgtcaagtccaccatccgccgtgttgatcccgaagcgttgaatggacgc
cagctactcaaggtggtttatgtggtcttggaatcccagtatcagagcgctttgtcggcg
gccgttagaaacattaaccgtaccaactccagcctggccattcagttaacgggctatttg
atcgaggagttgcgggacccggaaaattacgccaactttaaacatgacgtcagcgaagct
aatctcttcattgcttccctgatttttattgaagatctggccgataaggtggtggaagcg
gtaactccctatcgggacaatttggatgcggcgatcgtgttcccctccatgccccaggtg
atgcgcctgaacaaaatgggttccttttccatggcgcaattgggccagtccaaaagtgcg
atcgcccagttcatgaaaaagcgcaaggaaaacagcagtggtgctggcttccaggatgcg
atgttgaaactgttgcggaccctgcccacggtgttgaaatatttgccggtggaaaaggcc
caggatgcccgtaattttatgctcagcttccagtattggttgggaggctcccaggagaac
ttggaaaacttcctgctgatgctgaccgacaagtatgtttatcctgatttgggcttggat
aaactggtcaactaccaggagccagtggtctatcccgatatgggcatttggcatcccctg
tccatgcagatgtttgaaaacgtgaaggattacctggagtggtataaccaacgtcccgac
atcagcgaagatctcaaagatcctttagccccctgcattggtctgattatgcaacgcacc
cacctcgtcaccggggatgatgcccattacgttggcatggtgcaggaattggaagccatg
ggggcccgagtgatctgcgtgttctccggcggtttagatttctccaagcctgtcaacgaa
tatttctgggataaatccgttaacggtgtggaacccctgcccattgtggatgcggtggtt
tcgttaactggttttgctctggtgggtggccccgctcgtcaagatcatccccgtgccatt
gaatccctgaaaaagctcaaccgtccctatatgtgcgccctgcccctggtgttccaaacc
acagaggagtgggaagccagcgatttaggtttacaccccatccaagtggcgttacaaatt
gccattcctgaactggacggggcgatcgaaccgattattctttccggtcgggatggttcc
accggtcgggccattgctctccaagaccgcctagaggcgatcgcccagcgggccatgaag
tgggctaatttacgcaaaaaacctaagctggataaaaaagttgccattaccgtattcagt
ttcccccccgataaaggcaatgtgggcacagcggcctatctggacgtgtttggctccatc
tatgaagtgatgaaaggcctccagggcaacggctacgatgtgcaagatttacccggttcc
gccaaggaattaatggaagcggtcatccacgatgcccaagcccaatacaacagcccagaa
ttaaacatcgcccatcgcatgtcggtggagcagtatgaacgcctgaccccctactcggtg
cggttggaggaaaattggggcaaaccccccggacatctgaacagcgacgggcaaaattta
ctgatctacggtaaggaattcggtaacgtcttcatcggtgtacaacccacctttggttac
gaaggggaccccatgcgcttgctattctcccgttccgccagtccccatcacggttttgcc
gcttactacacctatttgaaccacatttggaaagccgatgcggtattacatttcggcacc
cacggttctttggaatttatgcccggtaaacagatgggcatgtccggggaatgctatccc
gataatttgattggcaccattcccaacttgtactactacgccgccaacaatccttctgaa
gctaccatcgccaaacggcggggttatgcgtccaccatttcctacttgacccctcccgca
gaaaatgccggtttatacaaaggtttgcaggagttaaacgagctaattggctcctaccaa
accctgaaggattccggccggggcatccagattgttaataccatcatggaccaggcccgc
atctgtaaccttgaccaagatgtcaatttgcccgacatcaacgccgaggaaatggatcaa
ggtcagcgggataccattgtcggttccgtttaccgcaagctgatggaaattgagtctagg
ctcctgccctgtggtctccatgtcattggccagcccccaagcgccgaagaggcgatcgcc
accctggtaaacattgccagtttggaccgggaagatgaaggcatttgggctttgcctacc
ctgattgcggaaagcatcgggcgcaatatggaggaaatttaccgcaacagtgacaagggg
attttggccgacgtggaattgttgcaagacattaccctagctaccagggctgctgtggcc
gctctggtacaggaacaaattaatgccgacggtcgagtttcctttgtttccaagctgaac
ttcttcaaaattggcaaaaaagctccctgggtcaaatccctctgcgattccggctacccc
aacgtcaatgaagaaaaactcaaacccctgtttgaatacctggaattctgtttggaacag
gtttgtgccgacaacgaatttggtggcctactccaagccctggaaggggaatacgtcctg
cccggccctggtggcgaccccatccgtaaccccaatgtgttgcccacaggaaaaaatatc
cacgccctcgatccccaatccatccccaccctggccgctgtccaatccgccaaagtagtg
gtcgatcgcctgttggaacggcaacgcgccgaaaatggtggtaattatcccgaaaccatt
gcttctgtgctctggggtacggataacatcaaaacctacggcgaatccctggcccaaatt
atgtggatggtgggagccaaacccgtccccgatgccctcggtcgggtaaataaaatcgaa
ctggtgcccctggaagaactgggtcgcccccgcattgacgtggtggtgaattgttccggg
gtattccgggatctgtttattaaccaaatgaacctgttggatcaagcggtgaaactagcc
gccgaagccgatgaacccctggaaatgaacttcgttcgtaagcacgccctggaacaggca
gaagagatgggcattggcgtaagggaagcggccacccggattttctccaacgcctccggt
tcctattcttccaacgtcaacttagcggtagaaaacagcagttgggaagatgagtcggaa
ttgcaggaaatgtacctcaaacgcaagtccttcgctttcaactccgataaccccggcatg
atggaccaaaatcgggatatgttcgagcgggctttgaaaaccgccgatgccacattccag
aacttggattcctcggaaattagcctcaccgacgtatcccactacttcgactccgacccc
accaagttaatttccaccctgcgggatgacggcaaagcccccgccgcttacattgccgac
accaccaccgccaacgctcaggtacgtaccctatcggaaacggtgcgccttgatgcccgc
acgaaattgctcaatcccaaatggtacgaagggatgctttcccatggctacgaaggggtg
cgggaactatccaaacggttagtcaataccatgggctggagtgccactgccggcgcagtg
gataactgggtttatgaggatgccaacagcaccttcatcaaagatgaggaaatgtgcaaa
cggttaatggacttaaaccccaactctttccgccgcatggtcagcactttgttggaagtc
aatggccgcggctattgggagacttctgatgaaaacttggaacggctacaggaactttat
caagaagtggaagaccgcattgaaggggttgaataa

DBGET integrated database retrieval system