KEGG   Synechocystis sp. PCC 6803 PCC-N: SYNPCCN_0504Help
Entry
SYNPCCN_0504      CDS       T01778                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
sys  Synechocystis sp. PCC 6803 PCC-N
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sys01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:sys00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
555732..557036
Genome map
AA seq 434 aa AA seqDB search
MTRILKLSHLTPQQLNQLKRRSEQNIDQALAIAKEVIEQVKMEGDAGVLHYSRQFDFAGA
TAENLRVSEAEFAEAEKLVDPELRRAVEHAFRNIEKVHAGQMPPPMHLAEIEPGVFAGEK
ITPLPTVGLYVPRGKGAFPSMMLMLAVPARVAGVKKIVVCTPPDKEGKVEPVSLVTARMA
GVDEVYKLGGVQALAAIAYGTKTVSKVDKLIGPCSIYGAAAKRLLSGIVDVGLPAGPSES
IVLADETTDPKLAALDLLIEAEHGSDSAALLVTHSASLAEKALGYLGEYLEKLPPWRKKF
CEDGLGSYGGILLTDSLQASLDFINDYAPEHLQVLTADPLKLVGKIDNAGEILLGNYTPS
SAATYAIGVNAVLPTGGFARSYSAVSVFDFLKRSTLAYLTEEGFAGVKETVTTLADYEDF
PAHALAIRERENLL
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
gtgactcgtattcttaagctctcgcaccttaccccccaacaattaaaccaactcaaacgt
cgctcggaacaaaacattgaccaagccctggcgatcgccaaggaagttattgagcaggta
aaaatggagggagatgcgggggttttgcattacagccgtcagtttgacttcgctggggcc
acggcggaaaatttgcgggtgagtgaagcggaatttgccgaagcggaaaagttggtggat
cctgaactacggcgggcggtggaacacgcttttcgcaatattgaaaaggttcatgctggg
caaatgcctccccccatgcacctagcggaaattgagccgggggtatttgcgggggaaaaa
attacgcctctgcccacggtgggtttgtacgtgcccaggggtaagggggctttcccttcc
atgatgttgatgttggcggtgccggcccgggtggcaggggtaaagaaaattgtggtttgt
actccccctgacaaagagggaaaagtggagccggtttccttggtcactgcccgcatggcc
ggagtggatgaggtctataaattgggtggtgtccaggcccttgcggcaatcgcctacggc
accaaaacggttagcaaagtggataagctaattggcccctgcagcatttacggtgcggcg
gcgaaaagattactgtccggcattgttgatgtgggtttaccggcaggacccagtgagtcc
attgttttagctgatgaaaccactgaccccaagctggcggcgttggatttgttgatcgaa
gcggaacacggctccgactcagcggcgctgttggtgacccactctgcaagtttggcggaa
aaggcattgggttatttaggggaatacctggaaaaactccccccctggcgcaaaaagttt
tgtgaagatggtctgggttcctatggcggcattttgctcactgatagtttgcaagcttcc
ctagatttcattaacgattacgctccggaacatttgcaggtgttgacggcggaccccctc
aaattggtgggcaaaatcgacaatgcgggggaaattttgctgggcaattacactccgtct
tcagccgctacctatgccattggggtaaatgcggtgcttcccacgggaggctttgcccgt
tcctactcggcggtgtcggtgtttgatttcctcaagcgttctaccctagcttatttaacg
gaggaaggttttgctggggtgaaggaaacggtcactaccctagcggactatgaggatttt
ccagcccatgccctggccatacgggaacgggaaaatttgctttaa

DBGET integrated database retrieval system