KEGG   Synechocystis sp. PCC 6803 PCC-N: SYNPCCN_1019Help
Entry
SYNPCCN_1019      CDS       T01778                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sys  Synechocystis sp. PCC 6803 PCC-N
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sys00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SYNPCCN_1019 (ruvA)
Enzymes [BR:sys01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SYNPCCN_1019 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1132507..1133142)
Genome map
AA seq 211 aa AA seqDB search
MIQFLQGQVVTVTKNIQNRWFLILSVNGVGYELQVPHSLAQQWTPPPPEPQQVFTHLLVR
QDQIALFGFGRLAERDLFGQLMGVTGIGAQLAIALIETLGLEGLVQAVVTGNVKQLCQTP
GVGKKGAERLALELKTKLSQWHKLQMGTGETDSTLPTTALLEDLEMTLLALGYTQTEIQQ
AIAMVSQVPDVAQSEDPEVWIRQAIGWLSDH
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgattcaatttcttcagggccaggttgttacagtcacaaaaaatattcagaaccgttgg
tttttgattttgtccgttaatggggtgggttatgagttgcaggtgccccattccttagcc
caacaatggactccgccccccccggaaccccaacaggtttttacccacctcttggtacgc
caagaccagatcgctctttttggttttggccgcctggcagaaagggatttatttggtcaa
ttaatgggagtaaccggcattggggcccagttggcgatcgccctaattgaaacgttgggc
ttggaaggcttagtgcaagcggtggtaacgggcaatgtcaaacaattgtgccaaacgccg
ggggtcgggaaaaagggagcggaaaggttagccctagaactaaaaactaaattatcccaa
tggcacaaactacaaatggggaccggggaaactgactctactctgcccaccactgccctc
ctggaagacctggaaatgaccttgttagcattgggttacacccaaacggaaatccagcag
gcgatcgccatggtcagtcaagttccagacgtggcccagagtgaagatccagaagtgtgg
atccgccaggcgatcggttggttaagtgatcactga

DBGET integrated database retrieval system