KEGG   Synechocystis sp. PCC 6803 PCC-N: SYNPCCN_1304Help
Entry
SYNPCCN_1304      CDS       T01778                                 

Gene name
slr1992
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
sys  Synechocystis sp. PCC 6803 PCC-N
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:sys00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SYNPCCN_1304 (slr1992)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SYNPCCN_1304 (slr1992)
Enzymes [BR:sys01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SYNPCCN_1304 (slr1992)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1435715..1436179
Genome map
AA seq 154 aa AA seqDB search
MPLPTSLTTLDGTPLAPEVIADKVVLFVNVASKCGLTPQYSGLVALDKAYGEKGLVIIGV
PCNQFGAQEPGSPEEIKDFTKTKYDVDFTLLEKQDVNGPNRSPLYQFLVGDGEDISWNFG
KFLIGRDGQVVARFDPQTKPDDTNLKAAIEKALG
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgccattacccacttccctgaccaccctggatggaacgcccctggccccggaggtcatt
gccgataaagttgtcctttttgttaacgttgccagtaagtgcggcttaaccccccaatac
agcggcctagtggctttggacaaggcctatggagaaaagggcttagtaattatcggtgtg
ccctgcaaccaatttggggcccaggaaccaggctccccagaggaaatcaaagatttcacc
aaaaccaagtacgacgttgatttcaccttgttggaaaagcaggacgtcaatggtcccaac
cgcagtcccctctaccaattccttgtgggggatggggaagatattagctggaactttggc
aaatttttaattggtcgggatggacaggtggtggctcgctttgacccccaaactaaaccc
gatgacactaatctcaaggcggcgatcgaaaaagccttgggctaa

DBGET integrated database retrieval system