KEGG   Synechocystis sp. PCC 6803 PCC-N: SYNPCCN_1390Help
Entry
SYNPCCN_1390      CDS       T01778                                 

Gene name
slr2079
Definition
hypothetical protein
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
sys  Synechocystis sp. PCC 6803 PCC-N
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sys00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sys00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:sys00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1536844..1537827
Genome map
AA seq 327 aa AA seqDB search
MGIGVNSDPKVVHHQSIPKPNAMAIANYRAITTKQWQTWVEAARLQALNGKLPQYIPQLS
LVDPGNFALDIGDQNGIIYEAGDTDLTFSLMSVVKPFLWLYILHHRGWQWAEQKVGDRPS
HLPFNSVEQLEQDGGYPRNTMVNSGAICLAGHIPGATIEQRCENFLTWLNHTAQCQLWLD
QELLASVHSLPNPRNLAIAHLLAAKGYVEDATLALETYNQLCCLSGCLKDLFKLGLMLQC
PQPPLQPDTTARVKATMAKAGLYEMSEAFFRRTGFICKSGVSGLILACLPAPSPTIFACY
SPPLNEEGNPVAPLALLEFLAEFTSRN
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggggattggcgtaaactcagatcccaaagtcgtacatcatcaatctatacctaaacct
aatgccatggcgatcgccaattacagagccattacaaccaaacaatggcaaacatgggta
gaagctgcccgtcttcaggccctcaacggtaagttaccccaatacattcctcagttgagc
ttggtcgatccaggtaattttgccctagacattggcgaccaaaacggcattatttacgaa
gcaggagatacagacttaacgtttagtttgatgagtgtggtcaaaccctttctgtggctt
tacatactccatcaccggggttggcagtgggccgagcaaaaagttggcgatcgcccttcc
catttaccttttaattccgtggagcaattggagcaggatgggggttatccccgcaacacc
atggtcaacagtggcgccatctgcctagcgggtcatattccgggggcaacgatagagcaa
cggtgtgaaaattttctcacttggttaaaccacaccgcccaatgtcaactctggcttgat
caggaactattggcttcagtccattccctacccaatccccgcaatctggcgatcgcccat
ttgttggcagcaaaaggttatgtggaagatgcgaccctggctctagaaacctataaccaa
ctttgttgtttgagtggttgcctcaaggatttattcaagctaggcctaatgttgcaatgt
ccccagccgccgttacaaccggacaccactgccagggtcaaagccaccatggccaaagca
ggactgtatgaaatgtcagaagcgttttttcggcgcaccggctttatttgcaaatcgggg
gtcagtggcctaattttggcttgtttgccggccccgtcaccgaccatttttgcctgctat
agtccgcctttgaatgaagaaggaaaccctgtggctcccctggcactattagagtttttg
gcagagttcacctctagaaattaa

DBGET integrated database retrieval system