KEGG   Synechocystis sp. PCC 6803 PCC-N: SYNPCCN_1808Help
Entry
SYNPCCN_1808      CDS       T01778                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
sys  Synechocystis sp. PCC 6803 PCC-N
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:sys03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1981324..1982187
Genome map
AA seq 287 aa AA seqDB search
MPELPEVETVCRGLNRLTLEQTIGGGEVLLDRSLAYPVSVEDFQKQITGCRLVGWQRRGK
YLLGELRSNQAPGPAGWLGCHLRMTGQLLWTERDQQRPRHTRVVLHFEGGWELRFVDTRT
FGKVWLLPGDRPWAEVMTGLGQLGPEPFGADFTAEYLYEKLKSSRRPLKNALLDQRLVAG
LGNIYADEVLFFCGFHPTMASNQVSLQDCELIHQQIQATLTAAIEAGGTSFSDYRQVTGI
NGNYGGMAQVYGREGEPCRHCGTVIAKIKLGGRSAHFCPQCQPKLER
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
gtgccagaactaccagaagttgaaacagtatgccgggggctcaatcgtttgaccctggag
cagaccatcgggggaggggaagtgttgcttgatcgcagtcttgcctaccccgtttctgtt
gaggattttcagaagcaaattaccggttgtcgtttggtgggctggcaacggcggggaaag
tatttgctgggggaacttagaagcaatcaagccccagggccggcgggatggttgggatgc
catttacgtatgacagggcagttactctggacagaacgggatcagcagagaccacgacac
actagggtggtgctccactttgagggcgggtgggagttacgttttgtggatacccgcacc
tttggcaaagtctggctcctaccaggcgatcgcccttgggctgaagtaatgacggggctg
ggacagttggggccagaaccctttggggcggattttacggcggaatatctctacgaaaag
ctgaaatccagtcgccgccctttaaaaaatgccctgctggatcaacggttggtggcaggc
ttgggtaatatttatgccgatgaagtcttatttttttgcggcttccatcccaccatggcg
agtaatcaggtgagtttgcaggactgtgaactgatacatcaacaaattcaagccacttta
acagcggccattgaggctggaggcactagtttcagcgattatcgccaggtgactggtatc
aatggtaattatggcggtatggcccaggtctatggtcgggaaggagaaccctgtcgtcat
tgtggtacagtgatcgccaaaattaaattgggagggcgatcggcccacttttgtccccag
tgtcagccaaaattagagcggtga

DBGET integrated database retrieval system