KEGG   Synechocystis sp. PCC 6803 PCC-N: SYNPCCN_2066Help
Entry
SYNPCCN_2066      CDS       T01778                                 

Gene name
xylR
Definition
xylose repressor
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sys  Synechocystis sp. PCC 6803 PCC-N
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sys00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SYNPCCN_2066 (xylR)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYNPCCN_2066 (xylR)
   00052 Galactose metabolism
    SYNPCCN_2066 (xylR)
   00500 Starch and sucrose metabolism
    SYNPCCN_2066 (xylR)
   00520 Amino sugar and nucleotide sugar metabolism
    SYNPCCN_2066 (xylR)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SYNPCCN_2066 (xylR)
   00524 Butirosin and neomycin biosynthesis
    SYNPCCN_2066 (xylR)
Enzymes [BR:sys01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SYNPCCN_2066 (xylR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2281608..2282591
Genome map
AA seq 327 aa AA seqDB search
MLVWLPWGVELARFSQFSLNGMSSPSSIHREVIGIDIGGSSIKFGRFLSNGDCTESLVLP
TPQPALPKAVYAQLAHGIDLLKNSACVAIGVGMPGPADAAGRVAQLAINLPQWHDIPLAD
WLEDHGQLPTVLENDANCAGLGEAWLGAGRDYRNFILLTLGTGVGGAVFLNGKLFTGPQG
AGGELGLISIETEGYPCNSGNRGSLEQHASAQTLRREMNLTGLELAQLAAKGDAEAIAYW
EKFGQRLGMGIANLVYVLTPEAVIIGGGLSASSSYFFPSMASEIEERVLLPSRRGLKILV
AQLGNRAGMIGAARLAWQKLVYRTDGP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
gtgctggtatggctcccctggggggtagaattagcaagattttcccaattttcccttaat
ggcatgagttctccctcttccatacatcgtgaagtcatcggcattgacattggtggttct
tccattaagtttggccggttcctgagcaatggagattgcaccgagtccttggttttgccc
accccccaaccggctttacccaaggcagtttatgctcagttggcccatggtattgacctg
ttgaaaaattcagcttgtgtggcgatcggtgttgggatgccgggaccagcggacgcagca
ggacgggtggcccagttggcaattaatttgccccagtggcacgacattcctttggcggat
tggttggaagaccatggacagttgccgacggtattggagaatgatgccaattgtgctggc
ttgggggaagcttggctcggagcgggcagggattatcgtaattttattttgcttaccctg
ggcacgggggtggggggggcggtgtttttaaatggcaaattgtttacggggccccaagga
gccgggggggaattgggactaatttccattgaaacggaaggctatccttgcaatagcggc
aatcggggttctttggagcaacatgcttctgcccaaaccctacggcgggaaatgaatttg
accggcctggaattggcccaattggccgccaagggggatgcggaggcgatcgcctactgg
gaaaagttcggccagcggttgggcatgggcattgcgaacttggtctatgtgttgacccca
gaggcagtaattattgggggagggctaagcgccagctccagttacttttttccctccatg
gcatcggaaattgaggaaagggtgctattaccttcccgtcggggattaaaaattttggtg
gcccaactgggtaaccgagctggcatgatcggtgcggcccgcctagcctggcaaaagttg
gtttatcgcaccgatggcccttga

DBGET integrated database retrieval system