KEGG   Synechocystis sp. PCC 6803 PCC-N: SYNPCCN_2178Help
Entry
SYNPCCN_2178      CDS       T01778                                 

Gene name
tpi
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sys  Synechocystis sp. PCC 6803 PCC-N
Pathway
sys00010  Glycolysis / Gluconeogenesis
sys00051  Fructose and mannose metabolism
sys00562  Inositol phosphate metabolism
sys00710  Carbon fixation in photosynthetic organisms
sys01100  Metabolic pathways
sys01110  Biosynthesis of secondary metabolites
sys01120  Microbial metabolism in diverse environments
sys01130  Biosynthesis of antibiotics
sys01200  Carbon metabolism
sys01230  Biosynthesis of amino acids
Module
sys_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sys00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYNPCCN_2178 (tpi)
   00051 Fructose and mannose metabolism
    SYNPCCN_2178 (tpi)
   00562 Inositol phosphate metabolism
    SYNPCCN_2178 (tpi)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SYNPCCN_2178 (tpi)
Enzymes [BR:sys01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SYNPCCN_2178 (tpi)
Exosome [BR:sys04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SYNPCCN_2178 (tpi)
  Exosomal proteins of bladder cancer cells
   SYNPCCN_2178 (tpi)
  Exosomal proteins of melanoma cells
   SYNPCCN_2178 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Hs1pro-1_N
Motif
Other DBs
NCBI-ProteinID: BAL33095
Position
2421435..2422163
Genome map
AA seq 242 aa AA seqDB search
MRKIIIAGNWKMHKTQAEAQAFLQGFKPLIEDAAESREVVLCVPFTDLSGMSQQLHGGRV
RLGAQNVHWEASGAYTGEISAAMLTEIGIHYVVIGHSERRQYFGETDETANLRVLAAQKA
GLIPILCVGESKAQRDAGETEQVIVDQVKKGLVNVDQSNLVIAYEPIWAIGTGDTCAATE
ANRVIGLIREQLTNSQVTIQYGGSVNANNVDEIMAQPEIDGALVGGASLEPQSFARIVNF
QP
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaaaaatcattattgcgggcaattggaaaatgcataagacgcaggcggaggcccaa
gcgtttttgcaggggtttaaacctttaatcgaagatgcggcggaaagtcgtgaggtggtg
ttgtgtgttcctttcaccgatttgagcggcatgtcccaacaactccatggcggtagggtc
cgcctaggggcacaaaatgtccattgggaagcgagtggggcctacacaggggaaatttca
gcggctatgttgacggaaatcggtattcattatgtggttatcggccacagtgaacgacgg
caatattttggggaaacggacgaaactgccaatttgagagtattggcggcccaaaaggcg
ggcttaattcccattctgtgtgtgggggaaagtaaggcgcaacgggatgccggagaaacg
gaacaggttatcgttgaccaagtgaaaaaaggcttggtgaatgtggatcaatctaaccta
gtcatcgcctacgagccgatttgggccattggtacaggggacacctgtgcggcaacggaa
gccaatcgggttattgggctgattcgggaacagttaactaattcccaggtcaccatccag
tatggcggttcggtcaatgccaacaatgtggatgaaattatggcccaaccggaaattgat
ggagccttggtgggaggagctagtctggaaccccagagctttgcccgcattgttaatttt
cagccctga

DBGET integrated database retrieval system