KEGG   Synechocystis sp. PCC 6803 PCC-N: SYNPCCN_2216Help
Entry
SYNPCCN_2216      CDS       T01778                                 

Gene name
sll0019
Definition
(GenBank) hypothetical protein
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
sys  Synechocystis sp. PCC 6803 PCC-N
Pathway
sys00900  Terpenoid backbone biosynthesis
sys01100  Metabolic pathways
sys01110  Biosynthesis of secondary metabolites
sys01130  Biosynthesis of antibiotics
Module
sys_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:sys00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SYNPCCN_2216 (sll0019)
Enzymes [BR:sys01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     SYNPCCN_2216 (sll0019)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: BAL33133
Position
complement(2467059..2468243)
Genome map
AA seq 394 aa AA seqDB search
MVKRISILGSTGSIGTQTLDIVTHHPDAFQVVGLAAGGNVALLAQQVAEFRPEIVAIRQA
EKLEDLKAAVAELTDYQPMYVVGEEGVVEVARYGDAESVVTGIVGCAGLLPTMAAIAAGK
DIALANKETLIAGAPVVLPLVEKMGVKLLPADSEHSAIFQCLQGVPEGGLRRIILTASGG
AFRDLPVERLPFVTVQDALKHPNWSMGQKITIDSATLMNKGLEVIEAHYLFGLDYDHIDI
VIHPQSIIHSLIEVQDTSVLAQLGWPDMRLPLLYALSWPERIYTDWEPLDLVKAGSLSFR
EPDHDKYPCMQLAYGAGRAGGAMPAVLNAANEQAVALFLQEKISFLDIPRLIEKTCDLYV
GQNTASPDLETILAADQWARRTVLENSACVATRP
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaacgcatttctatcctcggctccaccggttccattggtacccaaactctggac
attgttacccatcatcctgatgcttttcaggtggtcggtttagcggctgggggaaatgtt
gcattactagcccaacaggtggcggagtttcgcccagagattgttgcgattcgtcaggca
gaaaagttagaggacctaaaagcagcagtggccgaactaactgattaccaacccatgtac
gtggtgggggaagaaggggtggtggaagtggcccgttatggtgatgcagaaagtgtggtc
acaggtattgtcggttgtgcgggattattacccaccatggcggcgatcgccgccgggaaa
gatattgctttagccaataaggaaacgttaattgccggagctccggtggtgttacccctg
gtggaaaaaatgggggtgaagttattgccggcggattcagaacattcagccatttttcaa
tgtttacagggggttcccgaaggggggttacggcggatcattctcaccgcttccggggga
gcattccgggacttgccggtggaaagattaccgtttgtaacagtacaggatgccctcaaa
catcccaactggtctatgggacaaaaaatcaccattgattccgccacattgatgaacaag
ggtttggaggtgattgaagcccattatctatttggcttggactacgatcatatagacatt
gtcattcatccccaaagcattattcattctttaattgaggtgcaggatacttctgtgcta
gctcaactggggtggcctgatatgcgtttgccgttgctctatgccctatcttggccagaa
agaatttacaccgactgggaacctttggatttagttaaagccggtagcttgagttttcgg
gagccagatcacgataaatatccctgcatgcaattggcctatggggccgggcgagctggg
ggagccatgccagcggtgttaaatgcggccaatgaacaggcggtggctttatttttgcaa
gaaaaaattagctttttggatattccccgtctgattgaaaagacctgtgacctctacgtt
ggtcaaaatactgctagccctgatttagaaacaattttggcagcggatcaatgggcccgg
cggacggtgttggaaaatagcgcctgtgtggctactcggccataa

DBGET integrated database retrieval system