KEGG   Synechocystis sp. PCC 6803 PCC-N: SYNPCCN_2536Help
Entry
SYNPCCN_2536      CDS       T01778                                 

Gene name
desC
Definition
delta-9 desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
sys  Synechocystis sp. PCC 6803 PCC-N
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:sys01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:sys01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2820395..2821351)
Genome map
AA seq 318 aa AA seqDB search
MLNPLNIEYLYLSKLFDNSLIVFNKRQLFRFFVRFFFMTAALPNDSKPKLTPAWTVIFFF
TSIHLVALLAFLPQFFSWKAVGMAFLLYVITGGIGITLGFHRCISHRSFNVPKWLEYIFV
ICGTLACQGGVFEWVGLHRMHHKFSDTTPDPHDSNKGFWWSHIGWMMFEIPAKADIPRYT
KDIQDDKFYQFCQNNLILIQVALGLILFALGGWPFVIWGIFVRLVFVFHFTWFVNSATHK
FGYVSHESNDYSRNCWWVALLTFGEGWHNNHHAYQYSARHGLQWWEVDLTWMTIKFLSLL
GLAKDIKLPPETAMANKA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgttaaacccattaaacattgaatacctatatttaagcaaactttttgacaatagttta
atcgtttttaacaagcgccaattattccgttttttcgttaggttttttttcatgactgct
gctcttcccaacgattccaagcccaagttgactccagcttggactgtgatcttctttttt
acctccattcatttggtggccctgttggctttcctgccccagtttttcagttggaaagca
gtggggatggctttcttgctctatgtaattaccggcggcattggcattactttaggtttt
caccgttgtatttcccaccgcagtttcaatgttcctaaatggttagagtatattttcgta
atctgtggcaccctagcctgtcaggggggcgtatttgagtgggtcggcttacaccgtatg
caccacaaattttctgacaccaccccggatccccacgattctaataagggtttttggtgg
agtcacatcggctggatgatgtttgaaattcctgctaaagctgatattccccgctacacc
aaggatatccaagacgataaattttatcaattttgccagaataatctaattcttatccag
gtcgccctaggcttgattttatttgccttagggggctggcccttcgttatttggggcatt
tttgtccgcctagtgtttgttttccacttcacttggtttgtcaacagtgccacccataag
ttcggctacgttagccatgaatccaatgattattcccgcaattgttggtgggtagcattg
ttaactttcggtgaaggttggcacaataatcaccacgcctatcagtactctgctcgccat
ggtttgcaatggtgggaagtggatttaacttggatgaccattaaattcctatctttgctg
gggttagccaaggatattaaacttcctccggaaactgcgatggccaacaaagcctag

DBGET integrated database retrieval system