KEGG   Synechocystis sp. PCC 6803 PCC-N: SYNPCCN_2559Help
Entry
SYNPCCN_2559      CDS       T01778                                 

Gene name
hemH
Definition
ferrochelatase
Orthology
K01772  
ferrochelatase [EC:4.99.1.1]
Organism
sys  Synechocystis sp. PCC 6803 PCC-N
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:sys00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2846912..2848075
Genome map
AA seq 387 aa AA seqDB search
MGRVGVLLLNLGGPEKLEDVRPFLFNLFADPEIIRLPFPWLQKPLAWLISTLRAKKSQAN
YAEIGGGSPLLQITEAQASALTTRLERLGQDAKVYIGMRYWHPFTEEAVEKIKGDRLQRL
VILPLYPHFSISTSGSSFRVLEEMWHNDPSLRQLDYSLIPSWYDHPGYLQAMADLIAQEL
KKFPNPDQAHIFFSAHGVPQSYVDEAGDPYQAEIEACTRLIMRTLDRPNQYTLAYQSRVG
PVEWLKPYTEEALQKLGAEGIDDLLVVPISFVSEHIETLQEIDIEYREIAEEAGIDNFQR
VPALNTHPVFIDALAQMVMDSLNDPPCTFETVPHPKKNMKMYPQERWEWGLTTAAEVWNG
RLAMLGFIALLVELISGQGPLHFVGLL
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgtgttggggtcttactgctaaatcttggcggaccggagaagttagaggatgta
cgccccttcctttttaacctgtttgcggatccggaaatcattcgtctcccttttccttgg
ttgcaaaaacccctggcatggctgatttctaccctacgggcgaaaaaatcccaggccaac
tacgccgaaatcggtggtggttcccccctgttgcagattaccgaagcccaagcctccgcc
ctcacgacccgtctggaacgccttggccaggatgcaaaagtgtacattggcatgcgctac
tggcacccctttacggaggaagccgtcgaaaaaattaaaggcgatcgcctgcaacggctg
gtgattttgcctctatatccccatttttccattagcactagcggctccagtttccgggtg
ttggaggaaatgtggcataacgaccccagtttgcggcaattggactatagcctgatcccc
tcttggtacgaccatccgggctatctccaggccatggcggatttgattgctcaagaatta
aagaaattccccaatccagaccaagcccatattttcttcagtgcccacggtgtgccccaa
agctatgtggatgaagcgggagacccctaccaggcagaaattgaagcctgtacccgtttg
ataatgcggactctcgatcgtccgaaccaatacacgttggcctaccaaagtcgggtgggg
ccagtggaatggctcaagccctacacggaagaagctctgcaaaaactgggggcggagggc
attgacgatctattggtggtgcccattagctttgtgtcagaacatattgaaaccctccag
gaaattgacatcgagtatcgggaaattgccgaagaagccggcattgataattttcagcgg
gtaccggccctaaacacccatccagttttcatcgacgccttggcccagatggtgatggat
tccctcaacgatcctccctgcacctttgaaacggtgccccatcccaaaaagaacatgaaa
atgtatccccaggaaagatgggaatggggtttgactacggcggcggaagtatggaatggt
cgcctcgccatgttgggtttcattgccctgttggtggagttgatcagcggccagggcccg
ttgcattttgtcggcttgctttag

DBGET integrated database retrieval system