KEGG   Synechocystis sp. PCC 6803 PCC-N: SYNPCCN_2647Help
Entry
SYNPCCN_2647      CDS       T01778                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sys  Synechocystis sp. PCC 6803 PCC-N
Pathway
sys00010  Glycolysis / Gluconeogenesis
sys00052  Galactose metabolism
sys00500  Starch and sucrose metabolism
sys00520  Amino sugar and nucleotide sugar metabolism
sys00521  Streptomycin biosynthesis
sys01100  Metabolic pathways
sys01110  Biosynthesis of secondary metabolites
sys01120  Microbial metabolism in diverse environments
sys01130  Biosynthesis of antibiotics
sys01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sys00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYNPCCN_2647 (glk)
   00052 Galactose metabolism
    SYNPCCN_2647 (glk)
   00500 Starch and sucrose metabolism
    SYNPCCN_2647 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    SYNPCCN_2647 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SYNPCCN_2647 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SYNPCCN_2647 (glk)
Enzymes [BR:sys01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SYNPCCN_2647 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: BAL33564
Position
complement(2942887..2943954)
Genome map
AA seq 355 aa AA seqDB search
MGAMGVNFLAGDIGGTKTILALVTINESSPGLARPVTLFEQTYSSPAFPDLVPMVQQFRQ
EAAFVLGNPISVAKACFAIAGPVIDNTCRLTNLDWHLSGDRLAQELAIAQVDLINDFAAV
GYGILGLGSEDLTVLQAAPVDPSGAIAILGAGTGLGQCYVIPQGQGRYRVFASEGAHGDF
APRSPLEWQLLEYLKKKYSLGRISIERVVSGMGIAMIYEFLRHQYPERESAQFSKLYQTW
NREKDQETKTVDLAAAVSQAALEGTDVLADQAMELFLGAYGAEAGNLALKLLPRGGLYVA
GGIAPKIIPLLEKGSFMQGFSDKGRMQSLMGTIPVQVVLNAKVGLIGAAVCAAQS
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgggggccatgggcgtaaattttttggcaggggatatcggcggcactaaaacgattctg
gccctggtgacgataaacgagagtagcccagggttggcccggccggtgactctgtttgaa
cagacctacagcagtccagcttttcccgatctggtgcccatggtgcaacaattccgtcaa
gaagcagcctttgtgttgggtaacccaatctccgttgctaaggcctgtttcgccattgcc
ggccctgtgatcgataacacctgtcgcctcactaatttagattggcatctcagcggcgat
cgcctggcccaggaattggccattgcccaggttgacctcatcaatgattttgccgctgtg
ggttacggcattttagggctagggtcagaggatttaaccgtactccaggccgctcccgtg
gatccgtcaggggcgatcgccatattgggagcaggcaccggcttgggacaatgctacgta
attccccagggccaaggaagatatcgagtttttgcctccgaaggagcccacggtgacttt
gccccccgatcgcctttggaatggcagttattggagtatctcaaaaagaagtattcccta
gggcggatttccattgaacgggtggtatccggcatgggcatcgccatgatttacgaattt
ttgcggcaccaatacccagaacgggaatcagcccaattcagcaaactctaccaaacctgg
aatcgagaaaaggaccaagaaaccaaaaccgtcgatctggccgccgccgtatcccaagcc
gccctggaaggcacagatgtattggctgaccaagccatggaactttttctcggggcctat
ggagcagaggcaggaaatcttgctttgaagctactacccagaggtggtttgtacgttgcc
ggtggtattgcccccaaaattatccctttactggaaaagggcagttttatgcaaggcttt
agcgacaaaggcaggatgcaaagcttaatggggacaattcccgtacaggtggtactcaac
gccaaagttggcctaattggcgcggcggtttgtgcggcccagtcttag

DBGET integrated database retrieval system